DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and acot21

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_690536.2 Gene:acot21 / 562047 ZFINID:ZDB-GENE-041001-181 Length:449 Species:Danio rerio


Alignment Length:232 Identity:47/232 - (20%)
Similarity:71/232 - (30%) Gaps:101/232 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LPKSRGVGVGVLAAFLLCFIFYYFYGGYMTL--ALFA----GIILLIFYYAQDL----------- 55
            :|..:|...|:|..::|       .||:..|  ||.|    .::.|.:...|||           
Zfish   168 MPPGKGPFPGILDTYIL-------RGGHFELRAALLAKRGFAVLALAYQNYQDLPKSSDKFHLEY 225

  Fly    56 --------------------LL--------------YHPDLPA-------NSRIYIPI--PTMHN 77
                                ||              :.||:.|       |:...:|:  ..|: 
Zfish   226 FEEGIDFLRQQPEVKGQKIGLLSISKSGDLALSMSTFLPDIAATVWINGCNANSVVPLYYKDMY- 289

  Fly    78 LPHITVSIK----TP-----------DDVTLHAFWVTQPEERSKSSPTLLYFHGNAGNMGHRMQN 127
            :|.:|:..|    ||           |.::........|.||   :|....|..:..||..|   
Zfish   290 IPPLTLDFKKKKITPLGLVDMLDVVKDPMSKEGLPSVIPIER---APGRFMFIASEANMNWR--- 348

  Fly   128 VWGIYH-HLHC---------NVLMVEYRGYGLSTGVP 154
              ..|| .|.|         |..:|:|...|....||
Zfish   349 --SAYHAKLACDRLKAHGKKNYELVKYEKAGHFIEVP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 25/110 (23%)
Abhydrolase_5 110..294 CDD:289465 14/55 (25%)
acot21XP_690536.2 Bile_Hydr_Trans 40..155 CDD:282610
BAAT_C 221..429 CDD:285986 32/172 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.