DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and si:ch211-117n7.6

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_021328354.1 Gene:si:ch211-117n7.6 / 555902 ZFINID:ZDB-GENE-060503-474 Length:344 Species:Danio rerio


Alignment Length:284 Identity:78/284 - (27%)
Similarity:119/284 - (41%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IPTMHNLPHITVSIKTPDDVTLH---------------AFWVTQPEERSK--------------- 106
            |||:.::....|.:..|.||.|:               ..|.|.||.|.|               
Zfish    50 IPTLQHVLSDFVDLSHPLDVGLNHTINVYLKPEEGVRVGVWHTVPEHRWKEAQGKNAEWYEKALG 114

  Fly   107 -SSPTLLYFHGNAGNMG--HRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAID 168
             .||..:|.|||.||..  ||: .|..:...|..:||:::|||:|.|||.|||.||.|||....:
Zfish   115 DGSPIFIYLHGNGGNRSALHRI-GVANVLSALGYHVLVMDYRGFGDSTGEPTEPGLTTDALYLYN 178

  Fly   169 YLHTRHDLDHSQLILFGRSLGGAVVVDVAADTV-YGQKLMCAIVENTFSSIPEMAVELVHP---- 228
            ::..|.  .:|.:.::|.|:|..|..:||...: .|:|....|:|....|....|.:..||    
Zfish   179 WIKKRS--GNSLVCVWGHSIGSGVTTNVAVKLLEEGKKFDGIILEGAMLSGRAAAKQYGHPFSWF 241

  Fly   229 --AVKYIPNLLF----KNK--YHSMSKIGKCSVPFLFISGLADNLVPPRMMRALY-----TKCGS 280
              ...||...||    .||  :.....:.|...|.|.:....|::.|..:.:.:|     .:...
Zfish   242 YWKFPYIQFFLFNPLKNNKIVFPLDENLEKIRTPILILHSKDDHVSPFSVAQEIYRIAKKAQNSD 306

  Fly   281 EIKRLLEFPGGSHNDTWIVDGYYQ 304
            |..:|:.| .|.|.  ::.:|.|:
Zfish   307 ERVKLVLF-DGKHG--YLHNGLYR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 78/284 (27%)
Abhydrolase_5 110..294 CDD:289465 59/203 (29%)
si:ch211-117n7.6XP_021328354.1 AXE1 77..>171 CDD:331847 32/94 (34%)
Abhydrolase_1 138..316 CDD:331148 50/180 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.