DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot5

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001073177.1 Gene:Acot5 / 503049 RGDID:1565917 Length:421 Species:Rattus norvegicus


Alignment Length:119 Identity:29/119 - (24%)
Similarity:46/119 - (38%) Gaps:26/119 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PKSRGVGVGVLA---AFLLCFIFYYFYGGYMTLALFAGIILLI---FYYAQDLLLYHPDLPANS- 66
            |:.:|.|:|:|.   ...||.....|..|.....:..|.::.:   .||.::      .|||:| 
  Rat   219 PQVKGPGIGLLGISKGAELCLSMASFLNGITAAVIINGSMVNVAGTLYYKEE------SLPASSM 277

  Fly    67 ---RIYIPIPTMHNLPHI-TVSIKTPDDV---------TLHAFWVTQPEERSKS 107
               ||.:......::..| ||..:.||..         |...|.|:|.:...||
  Rat   278 NLERIRVTKDGFKDIIDILTVPPEGPDQKSIIPVERSDTTFLFLVSQDDRNWKS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 11/46 (24%)
Abhydrolase_5 110..294 CDD:289465
Acot5NP_001073177.1 Bile_Hydr_Trans 17..137 CDD:282610
Abhydrolase 137..>253 CDD:304388 9/33 (27%)
BAAT_C 205..412 CDD:285986 29/119 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.