DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and abhd17a

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011208.1 Gene:abhd17a / 496639 XenbaseID:XB-GENE-5820301 Length:305 Species:Xenopus tropicalis


Alignment Length:211 Identity:58/211 - (27%)
Similarity:97/211 - (45%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRH 174
            |||:.||||.::|........:...::||:...:|.|||.|:|.|:|:.|..|..||...|.||:
 Frog   107 TLLFSHGNAVDLGQMTSFYLDLGTRINCNIFSYDYSGYGCSSGRPSEKNLYADIDAAWHALRTRY 171

  Fly   175 DLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCA--IVENTFSSIPEMAVELVHPAVK------ 231
            .:....::|:|:|:|....||:|:      :..||  |:.:..:|    .:.:|.|..|      
 Frog   172 GISPENILLYGQSIGTVPAVDLAS------RYECAAVILHSALTS----GMRVVLPDTKKTYCFD 226

  Fly   232 YIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDT 296
            ..||:         .|:.|.:.|.|.:.|..|.::......|||.:|...::.|. ..|..|||.
 Frog   227 AFPNI---------DKVSKITSPVLIMHGTEDEVIDFSHGLALYERCPKTVEPLW-VEGAGHNDI 281

  Fly   297 WIVDGYYQAIGGFLAE 312
            .....|.:.:..|:.:
 Frog   282 EQYSQYLERLKRFITQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 57/202 (28%)
Abhydrolase_5 110..294 CDD:289465 53/191 (28%)
abhd17aNP_001011208.1 FrsA <107..299 CDD:223999 58/211 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.