DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and CG1309

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_647880.1 Gene:CG1309 / 38519 FlyBaseID:FBgn0035519 Length:524 Species:Drosophila melanogaster


Alignment Length:191 Identity:40/191 - (20%)
Similarity:74/191 - (38%) Gaps:13/191 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ITVSIKTPDDVTLHAFWV-TQPEERSKSSPTLLYFHGNAG--NMGHRMQNVWGIYHHLHCNVLMV 142
            |...:||.|...:...:: .:|.........::...||||  .:|.....|     .|..:||..
  Fly   215 IRYKVKTIDSNEIDTLFIDNRPNNVGNGKTLVICSEGNAGFYEVGIMATPV-----ALKYSVLGW 274

  Fly   143 EYRGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQKLM 207
            .:.|:..|||.|..........|.:.:...........:||:|.|:||...:..|  :|| ..:.
  Fly   275 NHPGFAGSTGTPHPHQDKNAIDAVVQFAINNLRFPVEDIILYGWSIGGFSTLYAA--SVY-PDVK 336

  Fly   208 CAIVENTFSSIPEMAVELVHPAVKYIPNLLFKN--KYHSMSKIGKCSVPFLFISGLADNLV 266
            ..:::.||..:..:||..:..|:..|..:..:|  ..::.....:.:.|..||....|.::
  Fly   337 GVVLDATFDDVLYLAVPRMPAALAGIVKVAIRNYCNLNNAELANEFNGPISFIRRTEDEII 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 40/191 (21%)
Abhydrolase_5 110..294 CDD:289465 35/161 (22%)
CG1309NP_647880.1 Abhydrolase_5 245..>356 CDD:289465 28/118 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468273
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12277
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.