DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Y41E3.18

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001023462.2 Gene:Y41E3.18 / 3565105 WormBaseID:WBGene00044003 Length:481 Species:Caenorhabditis elegans


Alignment Length:239 Identity:56/239 - (23%)
Similarity:101/239 - (42%) Gaps:50/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DDVTLHAFWVTQPEERSK-----------SSP--TLLYFHGNAGNMGHRM---QNVWGIYHHLHC 137
            |||.....:|.:.:.::|           .:|  ||||.|.|..::...:   .::..|.....|
 Worm   239 DDVKYVRGFVLKTKNKNKIGCVYVGCPDGFAPRFTLLYSHPNGSDLSDHLIGIPSLIDIARFYRC 303

  Fly   138 NVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVY 202
            .|...:|.|||:|.|:.:|..|.:|.:|..:::.....:|..:::|.|.|:|.|..:::.... .
 Worm   304 EVYSYDYTGYGISGGIASESNLYSDIQAIYEHITLEKRVDPKKIVLLGYSIGSAATIELLRHE-Q 367

  Fly   203 GQKLMCAIVENTFSSIPEMAVELVHPAVKYIPNLLFKNK-----------YHSMSKIGKCSVPFL 256
            .||....|::...:||           ::.|..::.:.|           :.::.||.:..:|.|
 Worm   368 DQKPAGVILQAPPTSI-----------LRVIGGMMGRTKHLEKKTCCIDRFVTIDKIHEIQIPIL 421

  Fly   257 FISGLADNLVPPR-----MMRALYTKCGSEIKRLLEFPGGSHND 295
            .|.|.||..||..     ..||: ||...|     ..||.:|::
 Worm   422 VIHGKADKTVPVEHGKLICQRAI-TKVAPE-----WVPGAAHDN 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 56/239 (23%)
Abhydrolase_5 110..294 CDD:289465 49/202 (24%)
Y41E3.18NP_001023462.2 Hydrolase_4 304..458 CDD:378820 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.