DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and abhd17aa

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001082792.1 Gene:abhd17aa / 322121 ZFINID:ZDB-GENE-030131-840 Length:336 Species:Danio rerio


Alignment Length:209 Identity:58/209 - (27%)
Similarity:97/209 - (46%) Gaps:24/209 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRH 174
            |:|:.||||.::|.......|:...::||:...:|.|||:|||.|:|:.|..|..||...|.:|:
Zfish   141 TVLFSHGNAVDLGQMSSFYIGLGTRINCNIFSYDYSGYGVSTGKPSEKNLYADIDAAWHALRSRY 205

  Fly   175 DLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEMAVELVHPAVK------YI 233
            .:....:||:|:|:|....||:|:      :..||.|  ...|.....:.:..|..|      ..
Zfish   206 GISPENIILYGQSIGTVPTVDLAS------RYECAAV--VLHSPLTSGMRVAFPDTKKTYCFDAF 262

  Fly   234 PNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWI 298
            ||:         .|:.|.:.|.|.|.|..|.::......||:.:|...::.|. ..|..|||..:
Zfish   263 PNI---------EKVSKITSPVLIIHGTEDEVIDFSHGLALFERCPKAVEPLW-VEGAGHNDIEL 317

  Fly   299 VDGYYQAIGGFLAE 312
            ...|.:.:..|:::
Zfish   318 YSQYLERLRRFISQ 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 57/200 (29%)
Abhydrolase_5 110..294 CDD:289465 53/189 (28%)
abhd17aaNP_001082792.1 Hydrolase_4 136..312 CDD:288960 53/188 (28%)
Abhydrolase_5 141..313 CDD:289465 53/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.