DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot6

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001292214.1 Gene:Acot6 / 299193 RGDID:1309669 Length:422 Species:Rattus norvegicus


Alignment Length:316 Identity:63/316 - (19%)
Similarity:106/316 - (33%) Gaps:98/316 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 WVTQPE-------ERSKSSPTLL---YFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYR------ 145
            |..:||       :|...:|.::   ...|:..:.|.|:.......|.:...|..|..|      
  Rat    82 WAMEPERPFWRLIKRDVQTPLVVELEVLDGHEPDGGQRLAQAVHERHFMAPGVRRVPVREGRVRA 146

  Fly   146 ------GYGLSTGVPTERGLV---TDARAAI--------------------DYLHTRH------- 174
                  |.|..:|:....|.:   .:.||::                    :||...|       
  Rat   147 TLFLPPGEGQFSGIIDLYGSIGGLREYRASLLAGHGFAVLALAYFQFEDLPEYLSQVHLEYFEEA 211

  Fly   175 ---DLDHSQ-----LILFGRSLGGAVVVDVAA---DTVYGQKLMCAIVENTFSSIPEMAVELVHP 228
               .|.|.|     :.|.|.|.||.:.:.:||   |.:....|:.|.|.||.:  |....::..|
  Rat   212 VTFMLHHPQVKGPNIGLLGISKGGDLCLSMAAFLKDKITATVLINACVANTLA--PLYYKDMFIP 274

  Fly   229 AVKYIP------------------NLLFKNKYHSMSKIGKCSVPFLFISGLADN--------LVP 267
            .:.|.|                  |.|.:..:.|:..:.|...|||||.|:.|:        .:.
  Rat   275 NLGYDPTKHKILESGLLDLGDIWNNPLEEPNHQSLISLEKAQGPFLFIVGMDDHSWKSDVYARIA 339

  Fly   268 PRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVDGYYQAIGGFLAELQQQPLLKAPE 323
            .|.::|    .|.:..:::.:|...|   .|...|:.....|:......|:|...|
  Rat   340 SRRLQA----HGKDRPQIIYYPKSGH---CIDPPYFPPPIAFVPTAVSGPILSGGE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 59/296 (20%)
Abhydrolase_5 110..294 CDD:289465 51/265 (19%)
Acot6NP_001292214.1 Bile_Hydr_Trans 17..137 CDD:282610 10/54 (19%)
Aes 83..373 CDD:223730 58/298 (19%)
BAAT_C 203..413 CDD:285986 43/195 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.