DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and ABHD12

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_056415.1 Gene:ABHD12 / 26090 HGNCID:15868 Length:404 Species:Homo sapiens


Alignment Length:382 Identity:89/382 - (23%)
Similarity:152/382 - (39%) Gaps:96/382 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ALPKSRGVGVGVLAAFLLCFIFYYFYGGYMTLALFAGIILLIFYYAQDLLLYHPDLPANSRIYIP 71
            ||.:.:||.:. |...|.|.:..|....:: :.|..||...:.:.....:.|..||..       
Human    61 ALGRRKGVWLR-LRKILFCVLGLYIAIPFL-IKLCPGIQAKLIFLNFVRVPYFIDLKK------- 116

  Fly    72 IPTMHNLPH-ITVSIKTPDDVTLHAFWVTQP----------------EERSKSSPTLLYFHGNAG 119
             |....|.| ....::..:|||: ..|.|.|                :..:.|.|.:||.|||||
Human   117 -PQDQGLNHTCNYYLQPEEDVTI-GVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAG 179

  Fly   120 NMG--HRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDYLHTRHDLDHSQLI 182
            ..|  ||:: ::.:...|..:|:..:|||:|.|.|.|:|||:..||....|::..|.  ..:.:.
Human   180 TRGGDHRVE-LYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARS--GDNPVY 241

  Fly   183 LFGRSLGGAVVVDVAADTVYGQKLMC--------AIVENTFSSIPEMAVELVHP---AVKYIPNL 236
            ::|.|||..|..::.       :.:|        .|:|:.|::|.|.|..  ||   ..:|.|..
Human   242 IWGHSLGTGVATNLV-------RRLCERETPPDALILESPFTNIREEAKS--HPFSVIYRYFPGF 297

  Fly   237 --LFKN-------KYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPGGS 292
              .|.:       |:.:...:...|.|.|.:....|.:||.::.|.||:         :..|..|
Human   298 DWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYS---------IAAPARS 353

  Fly   293 -----------HNDTWIVDGYYQAIGGFLAELQQQPLLKAPEKS-------NVWVEL 331
                       |:|.    ||...   ::.:..:.|.:..|::.       ::|.||
Human   354 FRDFKVQFVPFHSDL----GYRHK---YIYKSPELPRILRPQQGPGSSPDPSMWSEL 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 70/282 (25%)
Abhydrolase_5 110..294 CDD:289465 55/216 (25%)
ABHD12NP_056415.1 Hydrolase_4 165..351 CDD:403389 55/206 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.