DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acnat1

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_006537902.1 Gene:Acnat1 / 230161 MGIID:2140197 Length:430 Species:Mus musculus


Alignment Length:264 Identity:60/264 - (22%)
Similarity:96/264 - (36%) Gaps:81/264 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 TLLYFHGNA---------GNMGHRMQNVWGIYHHLHCNVLM----VEYRGYG-LSTGVPTERGLV 160
            :||..||.|         .::..::|.|...|.....|.|:    ::..|.| :||....|.|| 
Mouse   193 SLLASHGFAVLALAYFAYKDLPEKLQEVDLEYFEEAANFLLSHPKIQQPGIGVISTSKGAEIGL- 256

  Fly   161 TDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTV-----YGQKLMCAIVENTFSSIPE 220
                |...||        .|:|       ..|.::.|..|.     | |.|:...::   .::..
Mouse   257 ----AMACYL--------KQVI-------ATVCINGATTTTAVPLRY-QDLVVTPIQ---QALER 298

  Fly   221 MAVELVHPAV------KYIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRM--MRAL--Y 275
            |.|. |..||      :|:.|   ||    :..:.|.....|||.|..|.|:..::  .||:  .
Mouse   299 MEVH-VSGAVCFRHTTQYLQN---KN----ILPVEKAQGKILFIVGENDELLDSKLHAQRAMDRL 355

  Fly   276 TKCGSEIKRLLEFPGGSHNDTWIVDGYYQAIGGFLAELQQQPLLKAP------------EKSNVW 328
            .:.|....|:|.:||..|    :::..|..    |.....||:|..|            .:.:.|
Mouse   356 RRHGRSSGRMLAYPGAGH----LIEPPYSP----LCFASWQPVLGRPMCFGGDLMAHAAAQEHSW 412

  Fly   329 VELE 332
            .|::
Mouse   413 REIQ 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 53/223 (24%)
Abhydrolase_5 110..294 CDD:289465 51/212 (24%)
Acnat1XP_006537902.1 Bile_Hydr_Trans 29..154 CDD:377407
BAAT_C 221..425 CDD:370148 53/236 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.