DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Abhd17b

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_666208.2 Gene:Abhd17b / 226016 MGIID:1917816 Length:288 Species:Mus musculus


Alignment Length:217 Identity:61/217 - (28%)
Similarity:100/217 - (46%) Gaps:28/217 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KSSP----TLLYFHGNAGNMGHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAA 166
            :.||    |||:.||||.::|.......|:...::||:...:|.|||.|:|.|||:.|..|..||
Mouse    85 RCSPNAKYTLLFSHGNAVDLGQMSSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADVEAA 149

  Fly   167 IDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEMAVELVHPAVK 231
            ...|.||:.:....:|::|:|:|....||:||    ..:....|:.:..:|    .:.:..|..|
Mouse   150 WLALRTRYGIRPENVIIYGQSIGTVPSVDLAA----RYESAAVILHSPLTS----GMRVAFPDTK 206

  Fly   232 ------YIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKCGSEIKRLLEFPG 290
                  ..||:         .||.|.:.|.|.|.|..|.::......||:.:|...::.|. ..|
Mouse   207 KTYCFDAFPNI---------DKISKITSPVLIIHGTEDEVIDFSHGLALFERCQRPVEPLW-VEG 261

  Fly   291 GSHNDTWIVDGYYQAIGGFLAE 312
            ..|||..:...|.:.:..|:::
Mouse   262 AGHNDVELYGQYLERLKQFVSQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 60/208 (29%)
Abhydrolase_5 110..294 CDD:289465 54/189 (29%)
Abhd17bNP_666208.2 FrsA <93..285 CDD:223999 59/209 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.