DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot6

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_766168.1 Gene:Acot6 / 217700 MGIID:1921287 Length:419 Species:Mus musculus


Alignment Length:225 Identity:49/225 - (21%)
Similarity:86/225 - (38%) Gaps:64/225 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PTLLYFHGNAGNM-GHRMQNVWGIYHHLHCNVLMVEYRGYGLSTGVPTERGLVTDARAAIDY--- 169
            |.::..:|:.|.: .||...:.|  |..  .||.:.|..:   ..:|..   ::|.|  ::|   
Mouse   158 PGIIDLYGSIGGLCEHRASLLAG--HGF--AVLALAYFQF---EDLPEN---LSDVR--LEYFEE 210

  Fly   170 ---LHTRH-DLDHSQLILFGRSLGGAVVVDVAA---DTVYGQKLMCAIVENTFSSIPEMAVELVH 227
               |..|| .:....:.|.|.|.|..:.:.:||   |.:....|:.|.|.||.  :|....:|  
Mouse   211 ALALMLRHPQVKGPNIGLIGVSKGADLCLSMAAFLKDNITATVLINACVANTL--VPLYYKDL-- 271

  Fly   228 PAVKYIPNL---LFKNK------------------YHSMSKIGKCSVPFLFISGLADNLVPPRMM 271
                ::|.|   ..|||                  :.|:..:.|...||||:.|:.|:    ...
Mouse   272 ----FVPELGCDQTKNKSGLMDLRDMWNNPLEEPNHQSLIPLEKAQGPFLFLVGMDDH----NWK 328

  Fly   272 RALYTK--C------GSEIKRLLEFPGGSH 293
            ..:|.:  |      |.:..:::.:|...|
Mouse   329 SDVYARIACERLQAHGKDRPQIIYYPETGH 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 49/225 (22%)
Abhydrolase_5 110..294 CDD:289465 48/224 (21%)
Acot6NP_766168.1 Bile_Hydr_Trans 17..137 CDD:282610
Aes 83..374 CDD:223730 49/225 (22%)
BAAT_C 203..410 CDD:285986 37/170 (22%)
Microbody targeting signal. /evidence=ECO:0000255 417..419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.