DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot5

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_663419.3 Gene:Acot5 / 217698 MGIID:2384969 Length:421 Species:Mus musculus


Alignment Length:260 Identity:52/260 - (20%)
Similarity:89/260 - (34%) Gaps:87/260 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MVEYRGYGLSTGVPTERGLVTDARA---------AIDYLHTRHD-------LDHSQLI-----LF 184
            ::|||. .|..|    :|....|.|         .||.||..:.       |.|.|:.     |.
Mouse   170 LLEYRA-SLLAG----KGFAVMALAYYKYDDLPKVIDILHLEYFEEAVTYLLSHPQVKGPGVGLL 229

  Fly   185 GRSLGGAVVVDVAADTVYGQKLMCAIVENTFS------------SIPEMAVELVHPAV-----KY 232
            |.|.|..:.:.:|:   :.:.:..|:|.|..:            |:|.:.:.|....|     |.
Mouse   230 GISKGAELSLSMAS---FLKGITAAVVINGATVNVISTLYYKEESLPGLGMHLERIKVTKDGFKD 291

  Fly   233 IPNLLFKN------KYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTK--------CGSEIK 283
            |.::|  |      ...|:..:.:....|||:.|..|:    ......|.:        .|.|..
Mouse   292 IIDIL--NVPLEAPDQKSLIPLERSDTAFLFLVGQDDH----NWKSEFYAREASKRLQAHGKEKP 350

  Fly   284 RLLEFPGGSHN-----DTWIV---DGYYQ---AIGGFLAELQQQPLLKAPEKSNVWVELE---HK 334
            :::.:|...|:     ..|.:   ..|:.   .:||       :|...|..:.:.|..|:   ||
Mouse   351 QIVCYPKTGHHIEPPYIPWSIAAPHSYFDKPILLGG-------EPRAHAMAQVDAWQRLQTFFHK 408

  Fly   335  334
            Mouse   409  408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 44/226 (19%)
Abhydrolase_5 110..294 CDD:289465 41/204 (20%)
Acot5NP_663419.3 Bile_Hydr_Trans 16..137 CDD:398442
Abhydrolase 145..>259 CDD:419691 23/96 (24%)
BAAT_C 204..412 CDD:400960 41/221 (19%)
Microbody targeting signal. /evidence=ECO:0000255 419..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.