DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and F01D5.7

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001022067.1 Gene:F01D5.7 / 175051 WormBaseID:WBGene00008497 Length:342 Species:Caenorhabditis elegans


Alignment Length:286 Identity:66/286 - (23%)
Similarity:112/286 - (39%) Gaps:59/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLYH-PDLPANSRIYI---------PIPTMHNLPHITVSIKTPDDV--TLHAFWVTQPEERS--- 105
            |.:| ||..|..||.:         .:...|:.|   |.:...|.|  .:..|.||..|:..   
 Worm    43 LAFHPPDKGATYRIELKSDPEKDLESVRDCHDEP---VQLVVRDRVHPEVKVFSVTTSEDSHLVC 104

  Fly   106 -KSSP------------TLLYFHGNAGNMGHRMQ----NVWGIYHHLHCNVLMVEYRGYGLSTGV 153
             |.||            .:|:...::.::|..:|    |.....:....:|...:|.|||.|:|.
 Worm   105 VKCSPNCYSKNPEVANQVVLFCQSSSADLGSFLQPNSMNFSTFANLFETDVYAFDYSGYGFSSGT 169

  Fly   154 PTERGLVTDARAAIDY-LHTRHDLDHSQLILFGRSLGGAVVVDVAA---DTVYGQKLMCAIVE-- 212
            .:|:.:..|.||..:: |.||.|   .::::.|.|:|....||:||   |.:.|..|:..:..  
 Worm   170 QSEKNMYADVRAVYEHILKTRPD---KKIVVIGYSIGTTAAVDLAASNPDRLVGVVLIAPLTSAL 231

  Fly   213 NTFSSIPEMAVELVHPAVKYIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTK 277
            ..|.:.|:.            ....:.:.:.|:.||...:...|...|..|..:|.....|||..
 Worm   232 RMFCNNPDK------------ETTWWGDSFLSIDKICHINTRVLICHGDHDQRIPMTHGMALYEN 284

  Fly   278 CGSEIKRLLEFPGGSHNDTWIVDGYY 303
            ..:.:..|: ..|.:|:.  |:.|.|
 Worm   285 LKNPVPPLI-VHGANHHS--IISGEY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 59/260 (23%)
Abhydrolase_5 110..294 CDD:289465 43/193 (22%)
F01D5.7NP_001022067.1 MhpC 148..320 CDD:223669 43/178 (24%)
Hydrolase_4 154..>226 CDD:378820 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R134
SonicParanoid 1 1.000 - - X3471
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.