DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Y71G12A.4

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_490914.3 Gene:Y71G12A.4 / 171759 WormBaseID:WBGene00022140 Length:468 Species:Caenorhabditis elegans


Alignment Length:187 Identity:46/187 - (24%)
Similarity:76/187 - (40%) Gaps:39/187 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 WVTQPEERSK-SSPTLLYF-HGNAGNMGHRMQ---NVWGIYHHLHCNVLMVEYRGYGLSTGVPTE 156
            |:.:.:.|.: .||.|:.| ..|:.::|..:.   |...|...|.|::|:.:|.|||:|.|...|
 Worm   204 WLHRDKNRQRLRSPNLIIFSQPNSSDLGCCLMMDPNFADIADFLQCDLLIYDYPGYGVSEGTTNE 268

  Fly   157 RGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQKLMCAIVENTFSSIPEM 221
            :.:.....|.:.|..........::||.|.|||.|.:|.||                      ||
 Worm   269 KNVYAAVEAVMKYAMGTLGYSQDKIILIGFSLGTAAMVHVA----------------------EM 311

  Fly   222 ----AVELVHPAVKYI------PNLL--FKNKYHSMSKIGKCSVPFLFISGLADNLV 266
                ||.|:.|...:.      |:::  :.:.:.|:.|......|.|...|..|.:|
 Worm   312 YKVAAVVLIAPFTSFFRIVCRRPSIIRPWFDMFPSLEKSKGIGSPTLICHGEKDYIV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 46/187 (25%)
Abhydrolase_5 110..294 CDD:289465 42/173 (24%)
Y71G12A.4NP_490914.3 Abhydrolase_1 217..393 CDD:366166 43/174 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.