DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot4

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_599008.3 Gene:Acot4 / 171282 MGIID:2159621 Length:421 Species:Mus musculus


Alignment Length:253 Identity:56/253 - (22%)
Similarity:98/253 - (38%) Gaps:82/253 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MVEYR-----GYGLST---------GVPTERGLVTDARAAIDYLH--TRHDLDHSQ-----LILF 184
            ::|||     |:|.:|         .:|.|..::     .:||..  .|:.|.|.:     :.|.
Mouse   170 LLEYRAGLVAGHGFATLALAFYDFEDLPKELNVI-----EVDYFEEAVRYMLRHPKVKGPDIGLL 229

  Fly   185 GRSLGGAVVVDVA------ADTV--------------YGQKLMCAI------VENTFSSIPEMAV 223
            |.|||..|.:.:|      :.||              |.|.::..:      ::..||.|.:: |
Mouse   230 GLSLGADVCLIMASFLNNVSATVSINGSAFSGNRHIKYKQTMIPPLGHDLRRMKVAFSGILDI-V 293

  Fly   224 ELVHPAVKYIPNLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPPRMMRALYTKC--------GS 280
            ::.:.||....|       .||..|.|...|.||::|..|:.    ....|||:.        |.
Mouse   294 DIRNDAVGGCEN-------PSMIPIEKAKGPILFVAGQDDHC----WRSELYTQIASDRLQAHGK 347

  Fly   281 EIKRLLEFPGGSHNDTWIVDGYYQAIGGFLAELQQQPLL-----KAPEKSNV--WVEL 331
            |..::|.:||..|   :|...|:......|.::..:.::     ||..|:.:  |.::
Mouse   348 ERPQVLSYPGTGH---YIEPPYFPMCPASLHKIVNEAVIWGGEVKAHSKAQIDAWKQI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 51/218 (23%)
Abhydrolase_5 110..294 CDD:289465 48/207 (23%)
Acot4NP_599008.3 Bile_Hydr_Trans 16..137 CDD:377407
Abhydrolase 137..>253 CDD:389770 21/87 (24%)
BAAT_C 204..412 CDD:370148 48/214 (22%)
Microbody targeting signal. /evidence=ECO:0000255 419..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.