DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot3

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_599007.1 Gene:Acot3 / 171281 MGIID:2159619 Length:432 Species:Mus musculus


Alignment Length:181 Identity:37/181 - (20%)
Similarity:59/181 - (32%) Gaps:71/181 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LHAFWVTQPEERSKSSPTLLYFHGNAGNMGHRMQNVWGIY--HHLHCNVLMVEYRGYGLSTGVP- 154
            :|||....|   ::.:||::            ::...|..  ..:|..|       .||:...| 
Mouse     1 MHAFTTQNP---NRMAPTVI------------LEPAGGCLCDQPVHIAV-------RGLAPEQPV 43

  Fly   155 TERGLVTDARAAIDYLHTRHDLD-HSQLIL-----FGRSLGG------------------AVVVD 195
            |.|.::.|.:.|:...|.|:..| |.:|.|     .|.|..|                  .:..|
Mouse    44 TLRSVLRDEKGALFRAHARYRADSHGELDLARTPALGGSFSGLEPMGLLWAMEPDRPFWRLIKRD 108

  Fly   196 VAADTVY------------GQKLMCAIVENTFSSIPEMAVELVHPAVKYIP 234
            |....|.            ||:|..|:.|..|.:          |.|:.:|
Mouse   109 VQTPFVVELEVLDGHEPDGGQRLARAVHERHFMA----------PGVRRVP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 37/181 (20%)
Abhydrolase_5 110..294 CDD:289465 32/164 (20%)
Acot3NP_599007.1 Bile_Hydr_Trans 28..148 CDD:282610 29/136 (21%)
Abhydrolase 148..>264 CDD:304388 1/2 (50%)
BAAT_C 214..423 CDD:285986
Microbody targeting signal. /evidence=ECO:0000255 430..432
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.