DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Acot2

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_598949.3 Gene:Acot2 / 171210 MGIID:2159605 Length:453 Species:Mus musculus


Alignment Length:220 Identity:43/220 - (19%)
Similarity:76/220 - (34%) Gaps:75/220 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AIDYLHTRHDLDHSQLILFGRSLGG---------------AVVVD--VAA---------DTVYGQ 204
            |::||.:..::....:.|.|.|.||               |||::  |||         :|:...
Mouse   252 AVNYLRSHPEVKGPGIGLLGISKGGELGLAMASFLKGITAAVVINGSVAAVGNTISYKDETIPPV 316

  Fly   205 KLMCAIVENTFSSIPEMAVELVHPAV---KYIPNLLFKNKYHSMSKIGKCSVPFLFISGLADN-- 264
            .|:...|:.|...:.::...|..|.|   .:||             :.:....|||:.|..|:  
Mouse   317 SLLRNQVKMTKDGLLDVVEALQSPLVDKKSFIP-------------VERSDTTFLFLVGQDDHNW 368

  Fly   265 ---LVPPRMMRALYTKCGSEIKRLLEFPGGSHNDTWIVDGYYQ--------------AIGGFLAE 312
               .....:.:.|... |.|..:::.:|...|   :|...|:.              ..||    
Mouse   369 KSEFYADEISKRLQAH-GKEKPQIICYPAAGH---YIEPPYFPLCSAGMHLLVGANITFGG---- 425

  Fly   313 LQQQPLLKAPEKSNVWVELE---HK 334
               :|...|..:.:.|.:|:   ||
Mouse   426 ---EPRAHAVAQVDAWQQLQTFFHK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 35/186 (19%)
Abhydrolase_5 110..294 CDD:289465 32/161 (20%)
Acot2NP_598949.3 Bile_Hydr_Trans 58..178 CDD:282610
Abhydrolase 186..>298 CDD:304388 11/45 (24%)
BAAT_C 244..451 CDD:285986 43/220 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.