DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and ABHD12B

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001193602.1 Gene:ABHD12B / 145447 HGNCID:19837 Length:362 Species:Homo sapiens


Alignment Length:291 Identity:74/291 - (25%)
Similarity:123/291 - (42%) Gaps:57/291 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IFYYAQDLLLYHPDLPANSRIYIPIPTMHNLPH-ITVSIKTPDDVTLHAFWVTQPEERSK----- 106
            :|....|:|:|.....|...:.:..|.: .:|| :...::....|.| ..|.|.|..|.:     
Human    64 VFLPLIDMLIYFNFFKAPFLVDLKKPEL-KIPHTVNFYLRVEPGVML-GIWHTVPSCRGEDAKGK 126

  Fly   107 -----------SSPTLLYFHGNAGN--MGHRMQNVW----GIYHHLHCNVLMVEYRGYGLSTGVP 154
                       .:|.::|.||:|.:  ..||::.|.    |.:|     ||.|:|||:|.|||.|
Human   127 DCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFH-----VLSVDYRGFGDSTGKP 186

  Fly   155 TERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVAADTVYGQK---LMCAIVENTFS 216
            ||.||.|||....::...|..:  :.:.|:|.|||..|..:.|  .|..:|   :...::|..|:
Human   187 TEEGLTTDAICVYEWTKARSGI--TPVCLWGHSLGTGVATNAA--KVLEEKGCPVDAIVLEAPFT 247

  Fly   217 SIPEMAVELVHPAVKYIPNL----------LFKNK--YHSMSKIGKCSVPFLFISGLADNLVPPR 269
            ::  ....:.:|.:|...|:          |.|:|  :.:...:...|.|.|.:.|..|..||..
Human   248 NM--WVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLE 310

  Fly   270 MMRALYT------KCGSEIKRLLEFPGGSHN 294
            ..:.||.      :....:|.::..||..||
Human   311 YGKKLYEIARNAYRNKERVKMVIFPPGFQHN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 69/267 (26%)
Abhydrolase_5 110..294 CDD:289465 57/210 (27%)
ABHD12BNP_001193602.1 Hydrolase_4 141..343 CDD:288960 59/212 (28%)
Abhydrolase_5 142..324 CDD:289465 54/192 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.