DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bem46 and Abhd12b

DIOPT Version :9

Sequence 1:NP_477372.1 Gene:Bem46 / 44441 FlyBaseID:FBgn0025109 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001181962.1 Gene:Abhd12b / 100504285 MGIID:2685650 Length:359 Species:Mus musculus


Alignment Length:292 Identity:74/292 - (25%)
Similarity:112/292 - (38%) Gaps:58/292 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 IFYYAQDLLLYHPDLPANSRIYIPIPTMHNLPHITVSIKTPDDVTLHAFWVTQPEER-------- 104
            ||....::|:|...:.|...:.:..|.. .:.|.......|:...|...|.|.|..|        
Mouse    61 IFPPLMNMLIYLNCITAPILVDLKRPET-KIAHTVNFFLKPEPKVLLGIWHTVPSYRGEEAKGKC 124

  Fly   105 --------SKSSPTLLYFHGNAGNMGH----RMQNVW--GIYHHLHCNVLMVEYRGYGLSTGVPT 155
                    |..:|.::|.||:..|...    ::..|.  |.:|     ||.|:|||:|.|||..|
Mouse   125 RCWYEASLSDGNPIIIYLHGSGINRAFCGRIKLTQVLSDGGFH-----VLSVDYRGFGDSTGTTT 184

  Fly   156 ERGLVTDARAAIDYLHTRHDLDHSQLILFGRSLGGAVVVDVA-ADTVYGQKLMCAIVENTFSSIP 219
            |.||.||.....::...|.  ..:.:.|:|.|||..|..:.| .....|..:...|:|..|::| 
Mouse   185 EEGLTTDIICVYEWTKARS--GRTPVCLWGHSLGTGVATNAARVLEAKGCPVDAIILEAPFTNI- 246

  Fly   220 EMAVELVHPAVKY---IP-------------NLLFKNKYHSMSKIGKCSVPFLFISGLADNLVPP 268
             .|..:..|.||.   :|             .::|.|.    ..:...|.|.|.:.|..|..||.
Mouse   247 -WAATINFPLVKMYWKLPGCLRTFVDALKEEKIVFPND----ENVKFLSSPLLILHGEDDRTVPL 306

  Fly   269 RMMRALYTKCGS-----EIKRLLEFPGGSHND 295
            ...:.||....|     |..:::.||.|.|:|
Mouse   307 EFGKQLYEIARSAYRNKERVKMVVFPPGFHHD 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bem46NP_477372.1 FrsA 72..305 CDD:223999 69/268 (26%)
Abhydrolase_5 110..294 CDD:289465 57/211 (27%)
Abhd12bNP_001181962.1 FrsA <132..357 CDD:223999 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D385100at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.