DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu1 and eIF5B

DIOPT Version :9

Sequence 1:NP_001163144.1 Gene:mEFTu1 / 44438 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001246599.1 Gene:eIF5B / 44261 FlyBaseID:FBgn0026259 Length:1144 Species:Drosophila melanogaster


Alignment Length:457 Identity:95/457 - (20%)
Similarity:158/457 - (34%) Gaps:163/457 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SRRAMSSARMLRMAGATATSTACKDWQRNGLLAAPRTGNMQQYLREYANEKKVFERTKPHCNVGT 87
            |||..:.||:|:                                |:...|||   |:......|.
  Fly   528 SRRLRAEARILK--------------------------------RQAEAEKK---RSTDELRAGV 557

  Fly    88 I---GHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGIT-----INVAHVEYQTET 144
            :   ||||.|||.:...:.:.                :..:.:|.|||     .||.....:.:|
  Fly   558 VCVLGHVDTGKTKILDKLRRT----------------HVQDSEAGGITQQIGATNVPIEAIKEQT 606

  Fly   145 RH------YGH-------TDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQI 196
            ::      :.|       .|.|||..:......|::..|.|||||....|..|||.|.:.|.|:.
  Fly   607 KYVKAAAGFEHRLPGLLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIESIQLLKKK 671

  Fly   197 GIDHIVVFINKVDAADEEMVDLVEMEIRELL------TEMGYDGDKIPVV-----KG-SALCALE 249
            ....||. :||:|.. .:...|...::|::|      |::.:......|:     :| :|....|
  Fly   672 KCPFIVA-LNKIDRL-YDWKQLARRDVRDVLKEQQSNTQLEFQQRTKDVILQFAEQGLNAALFYE 734

  Fly   250 DKSPE----------IGKEAILKLLQEVDSFIPTPV-------RELDKPFLLPVENVYSIPGRGT 297
            :..|:          |..|.:..||..:..|....:       .||....|    .|.::||.||
  Fly   735 NTDPKTYISLVPTSAISGEGMGNLLFMIADFCQNMLAKRLMYSEELQATVL----EVKALPGLGT 795

  Fly   298 VVTGRLERGVVKKG-----------------------------MECEFVGYNKVLKSTVTGVEMF 333
            .:...|..|.:::|                             ::..:|.|.:|  ....||::.
  Fly   796 TIDAILINGKLREGQTMVVAGTDGPIVTQIRSLLMPQPMKELRVKNAYVEYKEV--KAAQGVKIA 858

  Fly   334 HQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFI 398
            .:.||:|.||..|               ::..||      |::|    |.:::.....|..:|.|
  Fly   859 AKDLEKAIAGINL---------------LIAHKP------DEVE----ICTEEVARELKSALSHI 898

  Fly   399 QL 400
            :|
  Fly   899 KL 900

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 87/407 (21%)
EF_Tu 81..274 CDD:206671 53/235 (23%)
EFTU_II 282..368 CDD:293898 21/114 (18%)
mtEFTU_III 371..462 CDD:294005 7/30 (23%)
eIF5BNP_001246599.1 PRK04004 553..1129 CDD:235195 84/397 (21%)
IF2_eIF5B 557..769 CDD:206674 52/229 (23%)
aeIF5B_II 779..889 CDD:293904 27/140 (19%)
IF-2 890..993 CDD:288813 4/11 (36%)
IF2_aeIF5B_IV 1016..1110 CDD:293911
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464550
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.