DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu1 and mIF2

DIOPT Version :9

Sequence 1:NP_001163144.1 Gene:mEFTu1 / 44438 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_651621.2 Gene:mIF2 / 43382 FlyBaseID:FBgn0039588 Length:696 Species:Drosophila melanogaster


Alignment Length:276 Identity:90/276 - (32%)
Similarity:118/276 - (42%) Gaps:56/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 LLAAPRTGNM-QQYLREYANEKKVF-ERTKPHCNVGTI-GHVDHGKTTLTAAITKVLADKQLAES 114
            ::|.|...|. :|..|:.|...... |..:|...|.|: ||||||||||..::..  ||....| 
  Fly   130 VVATPEETNADEQKERDVAPRPPAAPELLQPRPPVVTVMGHVDHGKTTLLDSLRG--ADVAAGE- 191

  Fly   115 KKYNEIDNAPEEKARGITINVAHVEYQTETRHYGH----TDCPGHADYIKNMITGTAQMDGAILV 175
                         |.|||   .|:...|.|...|.    .|.||||.:......|....|..:||
  Fly   192 -------------AGGIT---QHIGAFTVTLENGERVTFLDTPGHAAFSAMRARGAVATDIIVLV 240

  Fly   176 VAATDGAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIREL------LTEMGYDG 234
            |||.||.|.||||.:.|||:..:. |:|.:||:|..:..    :|...|||      |.|.|.|.
  Fly   241 VAAEDGVMAQTREVIQLAKEAQVP-IIVALNKIDKPEAN----IEKSKRELAQMGLALEEHGGDV 300

  Fly   235 DKIPVVKGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVY----SIPGR 295
            ..||:   |||           |...|:||.|..|...|.:.....|..| ||.:.    :.|.|
  Fly   301 QVIPI---SAL-----------KGTNLELLAEAVSTQATLMGLKADPTGL-VEGIVVESKTDPRR 350

  Fly   296 GTVVTGRLERGVVKKG 311
            |.:.|..:.||.::||
  Fly   351 GKLSTAIVSRGTLRKG 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 84/255 (33%)
EF_Tu 81..274 CDD:206671 70/203 (34%)
EFTU_II 282..368 CDD:293898 11/34 (32%)
mtEFTU_III 371..462 CDD:294005
mIF2NP_651621.2 InfB 158..689 CDD:223606 83/248 (33%)
IF2_eIF5B 163..327 CDD:206674 70/201 (35%)
IF2_mtIF2_II 336..431 CDD:293903 11/32 (34%)
IF-2 482..575 CDD:288813
mtIF2_IVc 593..680 CDD:293893
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.