DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mEFTu1 and eEFSec

DIOPT Version :9

Sequence 1:NP_001163144.1 Gene:mEFTu1 / 44438 FlyBaseID:FBgn0024556 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_611584.1 Gene:eEFSec / 37444 FlyBaseID:FBgn0034627 Length:511 Species:Drosophila melanogaster


Alignment Length:311 Identity:85/311 - (27%)
Similarity:150/311 - (48%) Gaps:53/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEIDNAPEEKARGITINV----------AHV 138
            |:|.:||||.|||||..|::.:.:..         ..|..|:...||||:::          ||:
  Fly     6 NIGLLGHVDSGKTTLAKALSSISSTA---------AFDKNPQSVERGITLDLGFSGLLVDAPAHL 61

  Fly   139 EYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATDGAMPQTREHMLLAKQIGIDHIVV 203
            . |.|...:...||||||..|:.:|.|...:|..:|||.|..|...||.|.:::.:.:. ..::|
  Fly    62 P-QGEQLQFTFVDCPGHASLIRTIIGGAQIIDLMLLVVDAQKGKQTQTAECLIIGELLQ-KKLIV 124

  Fly   204 FINKVDAADEEM----VDLVEMEIRELLTEMGYDGDKIPV-----VKGSALCALEDKSPEIGKEA 259
            .|||:|...|..    ::.:.:.:.:.|....: |.::|:     ::|:.:..|.    |:.:||
  Fly   125 VINKIDVYPENQRASKLEKLRLRLAKTLEATTF-GGQVPICAVSALQGTHIAELR----EVLREA 184

  Fly   260 ILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVTGRLERGVVKKG--MECEFVGYNKV 322
            ..:           |.|.|..|..:.|::.:.|.|:|||.||.|.:|.|:..  :|...:|..:.
  Fly   185 YFQ-----------PQRNLADPLFMYVDHCFGIKGQGTVCTGTLLQGKVQVNNVIELPALGEQRK 238

  Fly   323 LKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKRGMVMCKPGSVKAL 373
            :||    ::||.:.:..|..||::|..|.......::|| ::.:||.:|.:
  Fly   239 VKS----IQMFRKNVTSASMGDRIGLCVTQFNAKLLERG-IITQPGYLKPI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mEFTu1NP_001163144.1 PRK00049 73..463 CDD:234596 85/311 (27%)
EF_Tu 81..274 CDD:206671 54/208 (26%)
EFTU_II 282..368 CDD:293898 24/87 (28%)
mtEFTU_III 371..462 CDD:294005 1/3 (33%)
eEFSecNP_611584.1 SelB_euk 5..192 CDD:206676 56/212 (26%)
SelB 6..467 CDD:225815 85/311 (27%)
SelB_II 196..278 CDD:293897 24/86 (28%)
eSelB_III 283..396 CDD:294009 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43721
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.