DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sec13 and SEH1H

DIOPT Version :10

Sequence 1:NP_651977.1 Gene:Sec13 / 44437 FlyBaseID:FBgn0024509 Length:356 Species:Drosophila melanogaster
Sequence 2:NP_564830.1 Gene:SEH1H / 842741 AraportID:AT1G64350 Length:326 Species:Arabidopsis thaliana


Alignment Length:109 Identity:23/109 - (21%)
Similarity:37/109 - (33%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DPNYPELDRSKMQMASLN-----------------GLLDTLEHDSTRQLGGGPDDYELVDSLAAR 80
            ||...|..|:.....|||                 ||:|....:..:.|.......:::||...:
plant     8 DPVTTESQRNPQVNVSLNILSQGSTEKSQELRQEPGLMDLASTEFLKSLRAATSPQKVLDSAEDK 72

  Fly    81 LGYPHANGDI-----KRSW-SKMNAAW-GKRLSG-GNRNSGWTK 116
            :.......:|     |..| :.:...| .|:.|| |..|..|.:
plant    73 VSKRRRTREISEAITKERWLALLRDVWKKKKQSGFGVNNDRWMR 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sec13NP_651977.1 WD40 <10..288 CDD:441893 23/109 (21%)
WD40 repeat 60..101 CDD:293791 6/46 (13%)
WD40 repeat 106..148 CDD:293791 5/12 (42%)
WD40 repeat 155..207 CDD:293791
WD40 repeat 215..256 CDD:293791
WD40 repeat 264..290 CDD:293791
SEH1HNP_564830.1 WD40 10..308 CDD:475233 21/107 (20%)
WD40 repeat 13..54 CDD:293791 8/40 (20%)
WD40 repeat 60..105 CDD:293791 7/44 (16%)
WD40 repeat 110..163 CDD:293791 2/7 (29%)
WD40 repeat 171..222 CDD:293791
WD40 repeat 229..277 CDD:293791
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.