DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs2st and usta

DIOPT Version :9

Sequence 1:NP_477339.1 Gene:Hs2st / 44433 FlyBaseID:FBgn0024230 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_009293006.1 Gene:usta / 557218 ZFINID:ZDB-GENE-041001-163 Length:411 Species:Danio rerio


Alignment Length:362 Identity:108/362 - (29%)
Similarity:181/362 - (50%) Gaps:65/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ALCAVT----CAG---YWL------LWSEIRLEHAFKPLSKLGDSLSPDQHASSTTDDFDFEEHL 73
            |.|..|    |.|   |.|      :..|||        ..||:|...|.|...|..:..|... 
Zfish    42 AFCMATLLLFCLGSLFYQLNGGPPKVLLEIR--------QYLGESTFVDDHGPPTPRELPFPSQ- 97

  Fly    74 VVLYNRVPKTGSTSFVNIAYDLCKPNKFHVLHINVTANMHVLSLPNQIQFVRN--VSRWHEM--- 133
             |:||||.|.||.:.|.:...|.:.::|::    |::::|     |:.:..::  ||.|.::   
Zfish    98 -VIYNRVGKCGSRTVVLLLRILAEKHQFNL----VSSDIH-----NKTRLTKHEQVSGWVDLITN 152

  Fly   134 -----KPALYHGHMAFLDFSKFQIAHKPIYINLVRKPLDRLVSYYYFLRFGD--NYRPNLVR--- 188
                 :|.||..|:.||:|::|:| .:|:|||::|.|::|.:|.|:|.||||  ..:.:|:|   
Zfish   153 ISNIPQPFLYTRHVHFLNFTRFRI-EQPVYINIIRDPINRFLSNYFFRRFGDWRGEQNHLIRTPQ 216

  Fly   189 -KKAGNKITFDECVVQKQPDCDPKNMWLQIPFFCGHAAECWEPGSSWALDQAKRNLVNEYFLVGV 252
             |.....:..:.|:::..|:|....::..:|:|||...:|.||| .||:::||:|::..:.|||:
Zfish   217 MKDDERYLDINVCIMENYPECSNPRLFYIVPYFCGQHPQCREPG-MWAVERAKQNVIENFLLVGI 280

  Fly   253 TEQMYEFVDLLERSLPRIFHGFREHYHNS---NKSHLRVTSSKLPPSESTIKSIQKTKIWQ---M 311
            .|::.:.:.||||.||..|......|.:.   ...:|..|..|..|   ||:::|  .::|   .
Zfish   281 LEELEDVLLLLERLLPHYFSDVLTIYKSPAFWKMGNLTGTVKKHMP---TIEALQ--VLYQRMKY 340

  Fly   312 ENDLYDFALAQFEFNKKKL----MQPDNKHVQKFMYE 344
            |.|.|:|...||...|||:    ...::.|...|:.|
Zfish   341 EYDFYNFIRDQFHLTKKKIGLKSSSQNSAHEPDFLRE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs2stNP_477339.1 Sulfotransfer_2 70..325 CDD:281554 85/276 (31%)
ustaXP_009293006.1 Sulfotransfer_2 97..>280 CDD:304664 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.