DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs2st and Ust

DIOPT Version :9

Sequence 1:NP_477339.1 Gene:Hs2st / 44433 FlyBaseID:FBgn0024230 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001101928.1 Gene:Ust / 361450 RGDID:1304743 Length:408 Species:Rattus norvegicus


Alignment Length:293 Identity:91/293 - (31%)
Similarity:155/293 - (52%) Gaps:24/293 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGDSLSPDQHASSTTDDFDFEEHLVVLYNRVPKTGSTSFVNIAYDLCKPNKFHVLHINVTANMH- 113
            ||:|...|.|....:....|...  |:||||.|.||.:.|.:...|.:.:.|.:    ||:::| 
  Rat    83 LGNSTYLDDHGPPPSKVLPFPSQ--VVYNRVGKCGSRTVVLLLRILSEKHGFKL----VTSDIHN 141

  Fly   114 --VLSLPNQIQFVRNVSRWHEMKPALYHGHMAFLDFSKFQIAHKPIYINLVRKPLDRLVSYYYFL 176
              .|:...|::.::|:|...:  |.|:..|:.||:||:|. ..:|:|||::|.|:.|.:|.|:|.
  Rat   142 KTRLTKNEQMELIKNISTVEQ--PYLFTRHVHFLNFSRFG-GDQPVYINIIRDPVSRFLSNYFFR 203

  Fly   177 RFGD--NYRPNLVR----KKAGNKITFDECVVQKQPDCDPKNMWLQIPFFCGHAAECWEPGSSWA 235
            ||||  ..:.:::|    ::....:..:||:::..|:|....::..||:|||....|.||| .||
  Rat   204 RFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPG-EWA 267

  Fly   236 LDQAKRNLVNEYFLVGVTEQMYEFVDLLERSLPRIFHGFREHY---HNSNKSHLRVTSSKLPPSE 297
            |::||.|:...:.|||:.|::.:.:.||||.||..|.|....|   .:....::.||..|..||.
  Rat   268 LERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSP 332

  Fly   298 STIKSIQKTKIWQMENDLYDFALAQFEFNKKKL 330
            ..::.:.:.  .:.|.:.|.:...||...|:||
  Rat   333 EAVQILYQR--MRYEYEFYHYVKEQFHLLKRKL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs2stNP_477339.1 Sulfotransfer_2 70..325 CDD:281554 82/266 (31%)
UstNP_001101928.1 Sulfotransfer_2 105..357 CDD:304664 81/263 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.