DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hs2st and UST

DIOPT Version :9

Sequence 1:NP_477339.1 Gene:Hs2st / 44433 FlyBaseID:FBgn0024230 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_005706.1 Gene:UST / 10090 HGNCID:17223 Length:406 Species:Homo sapiens


Alignment Length:311 Identity:95/311 - (30%)
Similarity:162/311 - (52%) Gaps:29/311 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGDSLSPDQHASSTTDDFDFEEHLVVLYNRVPKTGSTSFVNIAYDLCKPNKFHVLHINVTANMH- 113
            ||:|...|.|....:....|...  |:||||.|.||.:.|.:...|.:.:.|::    ||:::| 
Human    82 LGNSTYLDDHGPPPSKVLPFPSQ--VVYNRVGKCGSRTVVLLLRILSEKHGFNL----VTSDIHN 140

  Fly   114 --VLSLPNQIQFVRNVSRWHEMKPALYHGHMAFLDFSKFQIAHKPIYINLVRKPLDRLVSYYYFL 176
              .|:...|::.::|:|...:  |.|:..|:.||:||:|. ..:|:|||::|.|::|.:|.|:|.
Human   141 KTRLTKNEQMELIKNISTAEQ--PYLFTRHVHFLNFSRFG-GDQPVYINIIRDPVNRFLSNYFFR 202

  Fly   177 RFGD--NYRPNLVR----KKAGNKITFDECVVQKQPDCDPKNMWLQIPFFCGHAAECWEPGSSWA 235
            ||||  ..:.:::|    ::....:..:||:::..|:|....::..||:|||....|.||| .||
Human   203 RFGDWRGEQNHMIRTPSMRQEERYLDINECILENYPECSNPRLFYIIPYFCGQHPRCREPG-EWA 266

  Fly   236 LDQAKRNLVNEYFLVGVTEQMYEFVDLLERSLPRIFHGFREHY---HNSNKSHLRVTSSKLPPSE 297
            |::||.|:...:.|||:.|::.:.:.||||.||..|.|....|   .:....::.||..|..||.
Human   267 LERAKLNVNENFLLVGILEELEDVLLLLERFLPHYFKGVLSIYKDPEHRKLGNMTVTVKKTVPSP 331

  Fly   298 STIKSIQKTKIWQMENDLYDFALAQFEFNKKKLMQPDNKHVQKFMYEKIRP 348
            ..::.:.:.  .:.|.:.|.:...||...|:|...  ..||.|   ..:||
Human   332 EAVQILYQR--MRYEYEFYHYVKEQFHLLKRKFGL--KSHVSK---PPLRP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hs2stNP_477339.1 Sulfotransfer_2 70..325 CDD:281554 82/266 (31%)
USTNP_005706.1 Sulfotransfer_2 104..356 CDD:328972 81/263 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 387..406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3922
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375927at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.