DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IKKbeta and Aduk

DIOPT Version :9

Sequence 1:NP_524751.3 Gene:IKKbeta / 44432 FlyBaseID:FBgn0024222 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_731331.1 Gene:Aduk / 41112 FlyBaseID:FBgn0037679 Length:520 Species:Drosophila melanogaster


Alignment Length:526 Identity:130/526 - (24%)
Similarity:205/526 - (38%) Gaps:103/526 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NWERCRNLGEGGFGLVIHWRNRTTGREIATKHIKEMGALSADQQVKLSERWNKELNWSRQFKNFP 70
            ::|....||.|.:..|...|::......|.|:: ||..||...:    |....|:...|:.|: .
  Fly     8 DFEILEKLGAGSYATVYKARHKKQRTYHAIKYV-EMSTLSQTSR----ENLITEIRLLRELKH-K 66

  Fly    71 HIVAGVDIEDPDFLEYLNGMFSAKLPVIVLEYCNGGDVRKRLQSPENANGLTEFEVRQILGALRK 135
            :||...|.           .:..|...|||||||.|::...:::.:   .|.|...|..|..|..
  Fly    67 YIVTLQDF-----------FWDDKNIYIVLEYCNAGNLSAFIRTKK---ALPESTCRYFLRQLAA 117

  Fly   136 ALHFLHSQCGICHRDLKPDNIVIQRGVDGKKIYKLTDFGLARGTPDQTMVQSVVGTRHYYAPEVV 200
            |:.::.:. .:.|.||||.|:::.||.:...: |:.|||.|:......:.|.:.|:..|.|||:|
  Fly   118 AVQYMRAN-DVSHFDLKPQNLLLTRGANNVSL-KVADFGFAQHLKLGEINQQLKGSPLYMAPEIV 180

  Fly   201 ENGFYNSTVDLWSFGVIAYELVTGELPFIPHQTLKNIILNLIKKPAKCIAITEDPEDNTRFVNQF 265
            ....|::..||||.|||.||.:.|:.|: ..:|::.::|.:    .|..|||..|  |.|..|  
  Fly   181 RKHQYDAKADLWSIGVILYECLFGKAPY-SSRTIEELLLRI----RKAEAITLPP--NARISN-- 236

  Fly   266 ELPQTHHLSRPWAA-------QFTKWLASPL---------------------------NSNYKER 296
               :.|.|.|...|       .|..:.|.|.                           ..||||.
  Fly   237 ---ECHDLLRRLLAHEPTARISFADFFAHPFLDLKTFPTEHTLQKAIDLVTQACAYDEKHNYKEA 298

  Fly   297 GQLAANN----VPVVFADLD--KILNMNVLTIFAVNNCERL-------EYAVSAEMTMKDLIALI 348
            ..|..:.    ||::..:.|  |.|.:....:......|.:       ||.:.||...:...|. 
  Fly   299 YYLYCSALQYFVPLITEETDATKRLALRNRALSYTKRAEEIKNCIIEDEYRMLAERQRQAATAA- 362

  Fly   349 VLDTGMDEKELYFVLPTSHPHKT-----ITPKSTPLQLYVEEWSDTSKDSRKWTKRSNPPVMLYI 408
               |...|......:|.:.|..:     :.|.|...|||.   ...|..|.|..........||:
  Fly   363 ---TANQEPSSATQVPAAQPSSSRVAEMLEPDSRYKQLYA---LSNSSPSMKTGLEIGRKGELYL 421

  Fly   409 FQVKKECDYKIPEPILSILSRKFIANKFKTKERWLQKRVVLDMLYVLTKEQARYEMLVSGINERA 473
            ::.|.:...:.....|.||. .|:.|:.|.:.|    .::|..|....||....:.::|     |
  Fly   422 YERKLDAALESYTSALGILV-PFVNNEPKGERR----NLLLQQLEFWMKEAESIKSILS-----A 476

  Fly   474 LSLEDE 479
            ..|:||
  Fly   477 KHLDDE 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IKKbetaNP_524751.3 S_TKc 7..245 CDD:214567 68/237 (29%)
PKc_like 13..316 CDD:304357 91/342 (27%)
AdukNP_731331.1 S_TKc 9..265 CDD:214567 83/289 (29%)
PKc_like 13..264 CDD:304357 81/284 (29%)
MIT_2 274..348 CDD:239147 11/73 (15%)
MIT 407..472 CDD:282117 15/69 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.