DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IKKbeta and ERLIN1

DIOPT Version :9

Sequence 1:NP_524751.3 Gene:IKKbeta / 44432 FlyBaseID:FBgn0024222 Length:717 Species:Drosophila melanogaster
Sequence 2:NP_001094096.1 Gene:ERLIN1 / 10613 HGNCID:16947 Length:348 Species:Homo sapiens


Alignment Length:262 Identity:45/262 - (17%)
Similarity:92/262 - (35%) Gaps:77/262 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 NSFIDSIDKQRIIISFAYDQLTSLLKEA--------------------QAKIPSRQLISSAQWEK 527
            |.|..:...|.:.|.. :||:...||:|                    :.|||          |.
Human   127 NQFCSAHTLQEVYIEL-FDQIDENLKQALQKDLNLMAPGLTIQAVRVTKPKIP----------EA 180

  Fly   528 LNRNYNFIIQSAKSIRSFLEACLREAKDMVKTTNQLRKEVCEKDLFDCA--RFYKKY-------- 582
            :.|  ||.:..|:..:..:.|..::..:....|.:.:..:..:.:...|  ||.:|.        
Human   181 IRR--NFELMEAEKTKLLIAAQKQKVVEKEAETERKKAVIEAEKIAQVAKIRFQQKVMEKETEKR 243

  Fly   583 ---LCNGAIISPSELNNDAEEFAKSRFKLYNEGEARHLPKSIDHMHYLYFKTKESIPVLLQQFCD 644
               :.:.|.::..:...|||.:|..::...|:.:                        |..::.:
Human   244 ISEIEDAAFLAREKAKADAEYYAAHKYATSNKHK------------------------LTPEYLE 284

  Fly   645 IKKEIFQINLQMLMSASSTPPPKLELSAAMDRLAISSGSPSSDPFDSLRTINAIEEAERINNILV 709
            :||.....:...:...|:.|...::.|.|:....|.:|..||.|     :..|:|.:.  .|::.
Human   285 LKKYQAIASNSKIYFGSNIPNMFVDSSCALKYSDIRTGRESSLP-----SKEALEPSG--ENVIQ 342

  Fly   710 NE 711
            |:
Human   343 NK 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IKKbetaNP_524751.3 S_TKc 7..245 CDD:214567
PKc_like 13..316 CDD:304357
ERLIN1NP_001094096.1 SPFH_like_u3 23..310 CDD:259804 34/219 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..348 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4396
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.