DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cbp80 and LOC110440214

DIOPT Version :9

Sequence 1:NP_524750.2 Gene:Cbp80 / 44409 FlyBaseID:FBgn0022942 Length:800 Species:Drosophila melanogaster
Sequence 2:XP_021336960.1 Gene:LOC110440214 / 110440214 -ID:- Length:216 Species:Danio rerio


Alignment Length:189 Identity:94/189 - (49%)
Similarity:136/189 - (71%) Gaps:2/189 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 AANLPGTTVAHQLVVAIRQKCTPEEVVNILKDIPNSGYSGEEMSDGSFNALKIDVFVQTLLNLGS 559
            :.:|||..:|..:..||:.:.:.||::.||||:||.....::....|||.|||:||:||||:|.:
Zfish    17 SGSLPGYALATTVGNAIKNRASNEEILIILKDVPNPNQDEDDDEGDSFNPLKIEVFLQTLLHLAA 81

  Fly   560 KSFSHSFAAISKFHSVFRALAETEEAQICILHNIFELWSSHQQMMVVLIDKLLKLQIVDCSAVAT 624
            |||||||:|::|||.|.:.|.:::|.::.||..::|.|.||.:|:.||:|||::.|||||:|||.
Zfish    82 KSFSHSFSALAKFHEVLKTLTDSDEGKLHILRVLYEFWRSHPEMISVLVDKLIRTQIVDCAAVAN 146

  Fly   625 WIFSKEMTGEFTKLYLWEILHLTIKKMNKHVIKLNTELSEAKEKLAKADSSSSDSEDDS 683
            |:||.:|..:||:.|:|||||.||:||||||.|:..||.||||||.|  ..|...:|:|
Zfish   147 WVFSPDMAHDFTRFYVWEILHSTIRKMNKHVQKIQKELDEAKEKLEK--QQSKKVQDNS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cbp80NP_524750.2 MIF4G 31..243 CDD:214713
MIF4G_like 307..473 CDD:286213
MIF4G_like_2 494..764 CDD:286214 94/189 (50%)
LOC110440214XP_021336960.1 MIF4G_like_2 19..>192 CDD:312575 89/172 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130245at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.