DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSI1 and Hrb87F

DIOPT Version :9

Sequence 1:NP_002433.1 Gene:MSI1 / 4440 HGNCID:7330 Length:362 Species:Homo sapiens
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:360 Identity:103/360 - (28%)
Similarity:152/360 - (42%) Gaps:59/360 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    16 PHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQ 80
            |....|:|||||.::||.:||:.:|.::|.:.:.:||:||.|||||||||:|:.....:|.....
  Fly    20 PEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITYSQSYMIDNAQNA 84

Human    81 SRHELDSKTIDPKVAFPRRA--QPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFD 143
            ..|::|.:|::||.|.||:.  .|......||:|||||..:...|.:::||:.||::....::.|
  Fly    85 RPHKIDGRTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLREYFKDFGQIVSVNIVSD 149

Human   144 KTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGM- 207
            |.|.:.|||.|:.|:..|.|:|:.....|.|.||.::.|||..|:.|...|...||......|. 
  Fly   150 KDTGKKRGFAFIEFDDYDPVDKIILQKTHSIKNKTLDVKKAIAKQDMDRQGGGGGRGGPRAGGRG 214

Human   208 ---DAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTA 269
               |.   |.|..|:.| |.......::.|...|                               
  Fly   215 GQGDR---GQGGGGWGG-QNRQNGGGNWGGAGGG------------------------------- 244

Human   270 YGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTP-----SRTGGFLGTTSPGPMAELYGAANQDSGV 329
             |....:.......:|.||..|......|..|     ...||:.|....|     ||..|.:...
  Fly   245 -GGFGNSGGNFGGGQGGGSGGWNQQGGSGGGPWNNQGGGNGGWNGGGGGG-----YGGGNSNGSW 303

Human   330 SSYISAASPAPSTGFGHSL-----GGPLIATAFTN 359
            ..  :........|||:..     |||...:.|.|
  Fly   304 GG--NGGGGGGGGGFGNEYQQSYGGGPQRNSNFGN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSI1NP_002433.1 RRM1_MSI 21..96 CDD:409990 32/74 (43%)
PABP-1234 <32..339 CDD:130689 87/317 (27%)
RRM2_MSI 110..183 CDD:240769 26/72 (36%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 33/76 (43%)
RRM_SF 116..188 CDD:302621 26/71 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.