DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSI1 and sqd

DIOPT Version :9

Sequence 1:NP_002433.1 Gene:MSI1 / 4440 HGNCID:7330 Length:362 Species:Homo sapiens
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:222 Identity:86/222 - (38%)
Similarity:122/222 - (54%) Gaps:14/222 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    18 DPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSR 82
            |..|:|:|||||:||::.||::||::||::...|..||.|.|||||.|:.|.:...:|||.|...
  Fly    54 DDRKLFVGGLSWETTEKELRDHFGKYGEIESINVKTDPQTGRSRGFAFIVFTNTEAIDKVSAADE 118

Human    83 HELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTN 147
            |.::||.:|||         |...|..|||||||:...:.|::|.||.|||.:.:..:.|||..:
  Fly   119 HIINSKKVDPK---------KAKARHGKIFVGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKS 174

Human   148 RHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFML 212
            :.:||.|:||:||.:|..:.:....:|..|.|:.|:|.||......|..||..|   .||.....
  Fly   175 QRKGFCFITFDSEQVVTDLLKTPKQKIAGKEVDVKRATPKPENQMMGGMRGGPR---GGMRGGRG 236

Human   213 GIGMLGYPGFQATTYASRSYTGLAPGY 239
            |.|  |..|:........||.|...||
  Fly   237 GYG--GRGGYNNQWDGQGSYGGYGGGY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSI1NP_002433.1 RRM1_MSI 21..96 CDD:409990 36/74 (49%)
PABP-1234 <32..339 CDD:130689 77/208 (37%)
RRM2_MSI 110..183 CDD:240769 28/72 (39%)
sqdNP_731825.1 RRM_SF 58..129 CDD:302621 33/70 (47%)
RRM2_hnRNPD_like 137..211 CDD:240775 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.