DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MSI1 and SLIRP1

DIOPT Version :10

Sequence 1:NP_002433.1 Gene:MSI1 / 4440 HGNCID:7330 Length:362 Species:Homo sapiens
Sequence 2:NP_001027083.1 Gene:SLIRP1 / 3772560 FlyBaseID:FBgn0064117 Length:90 Species:Drosophila melanogaster


Alignment Length:85 Identity:27/85 - (31%)
Similarity:46/85 - (54%) Gaps:0/85 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   100 AQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVE 164
            |..|:.....:||||.|......::::.||.:||:|..|.::|||.|...:|:|||:|.|...:|
  Fly     6 AVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDKRTGCSKGYGFVSFNSLTALE 70

Human   165 KVCEIHFHEINNKMVECKKA 184
            |:.....|.:....:..:|:
  Fly    71 KIENEQKHILEGNYLNIQKS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MSI1NP_002433.1 RRM1_MSI 21..96 CDD:409990
PABP-1234 <32..339 CDD:130689 27/85 (32%)
RRM2_MSI 110..183 CDD:240769 24/72 (33%)
SLIRP1NP_001027083.1 RRM_SLIRP 16..88 CDD:409688 24/71 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.