DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp30 and GAF1

DIOPT Version :9

Sequence 1:NP_001259808.1 Gene:Rpp30 / 44392 FlyBaseID:FBgn0283652 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001154789.1 Gene:GAF1 / 836120 AraportID:AT5G59980 Length:705 Species:Arabidopsis thaliana


Alignment Length:336 Identity:90/336 - (26%)
Similarity:142/336 - (42%) Gaps:73/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYDFSIPYNK----------DDSVLR-ALLNELVETGYKTVAIDQSFD--HSKKD---------- 48
            |:|.|||||:          ....|| .|..:.:|.||..:|.::|..  .|.||          
plant     3 FFDLSIPYNEPPRSGGKEIAGGKTLRLKLATKAMELGYVGIAHNRSIKGVMSDKDSCTIPLLTLG 67

  Fly    49 ------PGKRGSEMFPEPHKIEHLRKEFQDKLRILQRITILYVDVNVAHAMSVSHN---LRKFNL 104
                  |....|..|   |: :.|........|...|:|: :|:.| |...|::..   |:.:::
plant    68 SLIKVAPRLASSVGF---HR-DLLGVPRTTPFRQYTRLTV-HVESN-AQCQSLNSGNPILKSYDI 126

  Fly   105 IAGQPKTDAALTHCCTAFNGDLITFDPVAGSRLLVNRKAYQVAVRRGMFFEIKYAPSICDSNNRK 169
            ||.:|....|..:.|.....|||:.|........:.....:.|::||::|||||:..:.|:..|:
plant   127 IAVRPMNQNAFDYACEKAEVDLISIDFTDKMLFRLKHPMVKAAIQRGIYFEIKYSDILMDAQTRR 191

  Fly   170 DMIKIAQNYCTKGKSKNVIFSSGAAHEFQLRGPYDVANLAFIFGLSEDQGKNAVDGHCRELFLKA 234
            .:|..|:......:.||:|.||||....:||||.||.||.|:.|||.::.:.|:..:||.:..|.
plant   192 QVISNAKLLVDWTRGKNLIISSGAPSVTELRGPNDVINLMFLLGLSAERARAAISKNCRNMIAKV 256

  Fly   235 --------EARRL-----GKTIMFLKGNGPIIYSDSSEDEKSTEDEMKGLKPQIGKAD------- 279
                    ||.|:     |.|.              |.::..:||.||..:...|:.|       
plant   257 LKKKRFHKEAVRVELLSAGDTF--------------SLEQPLSEDCMKWDRLSSGEGDMLLDDLA 307

  Fly   280 -AFEVKDGTEH 289
             ||:..:...|
plant   308 KAFDATNVVAH 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp30NP_001259808.1 RNase_P_p30 8..226 CDD:280117 71/249 (29%)
GAF1NP_001154789.1 RNase_P_p30 4..248 CDD:280117 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 80 1.000 Domainoid score I3014
eggNOG 1 0.900 - - E1_COG1603
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1197518at2759
OrthoFinder 1 1.000 - - FOG0004460
OrthoInspector 1 1.000 - - oto3533
orthoMCL 1 0.900 - - OOG6_102854
Panther 1 1.100 - - LDO PTHR13031
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.780

Return to query results.
Submit another query.