DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpp30 and rpp30

DIOPT Version :9

Sequence 1:NP_001259808.1 Gene:Rpp30 / 44392 FlyBaseID:FBgn0283652 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001016584.1 Gene:rpp30 / 549338 XenbaseID:XB-GENE-993926 Length:265 Species:Xenopus tropicalis


Alignment Length:247 Identity:81/247 - (32%)
Similarity:125/247 - (50%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FYDFSIPYNKDDSVLRALLNELVETGYKTVAIDQ--SFDHSKKDPGKRGS--EMFPEPHKIEHLR 67
            |.|.:|...||...|:.::......||.||||:.  .|:..|.:.||..|  |:|.....:    
 Frog     4 FVDLNITNCKDVKKLQNMIEMAAHLGYSTVAINHVFEFESKKMEIGKPISTKELFSTLPTV---- 64

  Fly    68 KEFQDK---LRILQRITILYVDVNVAHAM-SVSHNLRKFNLIAGQPKTDAALTHCCTAFNGDLIT 128
               |.|   ::||.|:||:..|.:..:.: |.|.:.|.::::|..|||:......||:.:.|||.
 Frog    65 ---QGKSIPIKILTRLTIIASDPSHCNVLRSTSPSTRLYDIVAVFPKTEKLFHAACTSIDVDLIC 126

  Fly   129 FDPVAGSRLLVNRKAYQVAVRRGMFFEIKYAPSICDSNNRKDMIKIAQNYCTKGKSKNVIFSSGA 193
            .:....:.....|.....|::||:|||:.|.|:|.||..|:..|..|.:.....|.||:|.||||
 Frog   127 INVTEKAPFFFRRPPINAAIQRGIFFELVYTPAIKDSTLRRYTISNALSLMQVCKGKNIIISSGA 191

  Fly   194 AHEFQLRGPYDVANLAFIFGLSEDQGKNAVDGHCRELFLKAEARRLGKTIMF 245
            ....::|||||:|.|..:|||:|...|.||..:||...|..|.|:....:::
 Frog   192 ERALEMRGPYDIATLGLLFGLTEGVAKAAVSTNCRSAVLHGETRKTAFGVVY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpp30NP_001259808.1 RNase_P_p30 8..226 CDD:280117 75/225 (33%)
rpp30NP_001016584.1 RNase_P_p30 5..223 CDD:376638 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6304
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38180
Inparanoid 1 1.050 121 1.000 Inparanoid score I4614
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004460
OrthoInspector 1 1.000 - - oto104680
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1168
SonicParanoid 1 1.000 - - X4844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.080

Return to query results.
Submit another query.