DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RFeSP and RIP1

DIOPT Version :9

Sequence 1:NP_001259876.1 Gene:RFeSP / 44390 FlyBaseID:FBgn0021906 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_010890.3 Gene:RIP1 / 856689 SGDID:S000000750 Length:215 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:100/183 - (54%)
Similarity:137/183 - (74%) Gaps:0/183 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SAYRRESVKDSRRRNDTAEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEI 110
            |.||..:..|..:.|:.|::.::::|.||||..:..:..||..|.|||.||:|:|:||||||:|:
Yeast    32 STYRTPNFDDVLKENNDADKGRSYAYFMVGAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEV 96

  Fly   111 KLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTH 175
            .|:.||.||:|..||:|||:||||||..||:...:|..|.|:||:.|..||..|:||:::|:|||
Yeast    97 NLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTH 161

  Fly   176 LGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLV 228
            ||||||..|||:||::|||||||||.||||||||||||||:|.:||..:.::|
Yeast   162 LGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RFeSPNP_001259876.1 UCR_TM 37..100 CDD:280989 20/53 (38%)
Rieske_proteo 92..230 CDD:273610 85/137 (62%)
Rieske_cytochrome_bc1 107..230 CDD:239552 74/122 (61%)
RIP1NP_010890.3 UCR_TM 32..87 CDD:397185 20/54 (37%)
Rieske_cytochrome_bc1 93..214 CDD:239552 73/120 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343041
Domainoid 1 1.000 109 1.000 Domainoid score I1408
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4378
Inparanoid 1 1.050 224 1.000 Inparanoid score I759
Isobase 1 0.950 - 0 Normalized mean entropy S616
OMA 1 1.010 - - QHG51988
OrthoFinder 1 1.000 - - FOG0003816
OrthoInspector 1 1.000 - - oto99844
orthoMCL 1 0.900 - - OOG6_101749
Panther 1 1.100 - - LDO PTHR10134
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1597
SonicParanoid 1 1.000 - - X2660
TreeFam 00.000 Not matched by this tool.
1413.880

Return to query results.
Submit another query.