DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RFeSP and AT5G13440

DIOPT Version :9

Sequence 1:NP_001259876.1 Gene:RFeSP / 44390 FlyBaseID:FBgn0021906 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_196848.1 Gene:AT5G13440 / 831185 AraportID:AT5G13440 Length:274 Species:Arabidopsis thaliana


Alignment Length:232 Identity:106/232 - (45%)
Similarity:144/232 - (62%) Gaps:13/232 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 NAVSRAYVRG-GAQVLSTGLK---ASGVAVNSMANRQAHTDLQVPDFSAYRRESVKDSRRRNDTA 63
            |:..|:.:|| .:||::.|.:   .|.|.....|.:..::.:...|.:..|......|:|     
plant    52 NSYHRSVIRGFASQVITQGNEIGFGSEVPATVEAVKTPNSKIVYDDHNHERYPPGDPSKR----- 111

  Fly    64 EERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGK 128
                ||:|.::..|....|...:.||...|.|||||.:|||:|.:|:.|..|..|.:||.|||||
plant   112 ----AFAYFVLSGGRFVYASVLRLLVLKLIVSMSASKDVLALASLEVDLGSIEPGTTVTVKWRGK 172

  Fly   129 PLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCP 193
            |:|||.||..:|:...:|...:||||:.|..||..||||:|:||||||||:|:.||||:||::||
plant   173 PVFIRRRTEDDIKLANSVDVGSLRDPQEDSVRVKNPEWLIVVGVCTHLGCIPLPNAGDYGGWFCP 237

  Fly   194 CHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230
            |||||||.||||||||||.||||||:.|..|..|::|
plant   238 CHGSHYDISGRIRKGPAPYNLEVPTYSFLEENKLLIG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RFeSPNP_001259876.1 UCR_TM 37..100 CDD:280989 16/62 (26%)
Rieske_proteo 92..230 CDD:273610 84/137 (61%)
Rieske_cytochrome_bc1 107..230 CDD:239552 74/122 (61%)
AT5G13440NP_196848.1 UCR_TM 86..145 CDD:308525 17/67 (25%)
Rieske_cytochrome_bc1 151..274 CDD:239552 74/122 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1312
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4378
Inparanoid 1 1.050 201 1.000 Inparanoid score I1311
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174160at2759
OrthoFinder 1 1.000 - - FOG0003816
OrthoInspector 1 1.000 - - otm3126
orthoMCL 1 0.900 - - OOG6_101749
Panther 1 1.100 - - O PTHR10134
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2660
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.970

Return to query results.
Submit another query.