DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RFeSP and AT5G13430

DIOPT Version :9

Sequence 1:NP_001259876.1 Gene:RFeSP / 44390 FlyBaseID:FBgn0021906 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_568288.1 Gene:AT5G13430 / 831184 AraportID:AT5G13430 Length:272 Species:Arabidopsis thaliana


Alignment Length:233 Identity:107/233 - (45%)
Similarity:145/233 - (62%) Gaps:13/233 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MNAVSRAYVRG-GAQVLSTGLK---ASGVAVNSMANRQAHTDLQVPDFSAYRRESVKDSRRRNDT 62
            :::..|:.:|| .:|||:.|.:   .|.|.....|.:..::.:...|.:..|......|:|    
plant    49 LSSYHRSLIRGFSSQVLAQGNEIGFGSEVPATVEAVKTPNSKIVYDDHNHERYPPGDPSKR---- 109

  Fly    63 AEERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRG 127
                 ||:|.::..|....|...:.||...|.|||||.:|||:|.:|:.|..|..|.:||.||||
plant   110 -----AFAYFVLSGGRFVYASVLRLLVLKLIVSMSASKDVLALASLEVDLGSIEPGTTVTVKWRG 169

  Fly   128 KPLFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYC 192
            ||:|||.||..:|:...:|...:||||:.|..||..||||||:||||||||:|:.||||:||::|
plant   170 KPVFIRRRTEDDIKLANSVDVGSLRDPQEDSVRVKNPEWLVVVGVCTHLGCIPLPNAGDYGGWFC 234

  Fly   193 PCHGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230
            ||||||||.||||||||||.||||||:.|..|..|::|
plant   235 PCHGSHYDISGRIRKGPAPYNLEVPTYSFLEENKLLIG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RFeSPNP_001259876.1 UCR_TM 37..100 CDD:280989 16/62 (26%)
Rieske_proteo 92..230 CDD:273610 85/137 (62%)
Rieske_cytochrome_bc1 107..230 CDD:239552 75/122 (61%)
AT5G13430NP_568288.1 UCR_TM 84..143 CDD:367251 17/67 (25%)
Rieske_cytochrome_bc1 149..272 CDD:239552 75/122 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 157 1.000 Domainoid score I1312
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4378
Inparanoid 1 1.050 201 1.000 Inparanoid score I1311
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1174160at2759
OrthoFinder 1 1.000 - - FOG0003816
OrthoInspector 1 1.000 - - otm3126
orthoMCL 1 0.900 - - OOG6_101749
Panther 1 1.100 - - LDO PTHR10134
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.970

Return to query results.
Submit another query.