DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RFeSP and UQCRFS1

DIOPT Version :9

Sequence 1:NP_001259876.1 Gene:RFeSP / 44390 FlyBaseID:FBgn0021906 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_005994.2 Gene:UQCRFS1 / 7386 HGNCID:12587 Length:274 Species:Homo sapiens


Alignment Length:231 Identity:144/231 - (62%)
Similarity:171/231 - (74%) Gaps:11/231 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VSRAYVRGGA----QVLSTGLKASGVAVNSMANRQAHTDLQVPDFSAYRRESVKDSRRRN-DTAE 64
            :||..:.|.|    .|.|.||........|      |||::|||||.|||..|.||.:.: :::|
Human    50 LSRESLSGQAVRRPLVASVGLNVPASVCYS------HTDIKVPDFSEYRRLEVLDSTKSSRESSE 108

  Fly    65 ERKAFSYLMVGAGAVGGAYAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGKP 129
            .||.||||:.|...||.|||||..|..|:.||||||:|||:||||||||||||||::.|||||||
Human   109 ARKGFSYLVTGVTTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKP 173

  Fly   130 LFIRHRTAAEIETERNVPTSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPC 194
            ||:||||..|||.|..|..|.||||:.|..||.||||:::|||||||||||||||||:|||||||
Human   174 LFVRHRTQKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC 238

  Fly   195 HGSHYDASGRIRKGPAPLNLEVPTHEFPNEGLLVVG 230
            ||||||||||||.|||||||||||:||.::.:::||
Human   239 HGSHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RFeSPNP_001259876.1 UCR_TM 37..100 CDD:280989 35/63 (56%)
Rieske_proteo 92..230 CDD:273610 103/137 (75%)
Rieske_cytochrome_bc1 107..230 CDD:239552 92/122 (75%)
UQCRFS1NP_005994.2 Ubiq-Cytc-red_N 2..76 CDD:286274 8/25 (32%)
UCR_TM 80..145 CDD:280989 36/64 (56%)
Rieske_proteo 110..274 CDD:273610 118/163 (72%)
Rieske_cytochrome_bc1 151..274 CDD:239552 92/122 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144541
Domainoid 1 1.000 182 1.000 Domainoid score I3465
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4378
Inparanoid 1 1.050 284 1.000 Inparanoid score I2868
Isobase 1 0.950 - 0 Normalized mean entropy S616
OMA 1 1.010 - - QHG51988
OrthoDB 1 1.010 - - D1174160at2759
OrthoFinder 1 1.000 - - FOG0003816
OrthoInspector 1 1.000 - - otm41618
orthoMCL 1 0.900 - - OOG6_101749
Panther 1 1.100 - - LDO PTHR10134
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1597
SonicParanoid 1 1.000 - - X2660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.