DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RFeSP and uqcrfs1

DIOPT Version :9

Sequence 1:NP_001259876.1 Gene:RFeSP / 44390 FlyBaseID:FBgn0021906 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001096664.1 Gene:uqcrfs1 / 406359 ZFINID:ZDB-GENE-040426-2060 Length:273 Species:Danio rerio


Alignment Length:213 Identity:137/213 - (64%)
Similarity:171/213 - (80%) Gaps:6/213 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SGVAVNSMAN-----RQAHTDLQVPDFSAYRR-ESVKDSRRRNDTAEERKAFSYLMVGAGAVGGA 82
            ||:||:|..|     |.||||:::||||.||| |.:..:::..::.:.|:||||||.|:..|.|.
Zfish    61 SGLAVSSSLNARSSVRFAHTDIKIPDFSDYRRPEVLNPNKQSQESGDARRAFSYLMTGSTLVVGV 125

  Fly    83 YAAKGLVNTFIGSMSASAEVLAMAKIEIKLSDIPEGKSVTFKWRGKPLFIRHRTAAEIETERNVP 147
            |.||.:|..|:.||||||:|||::||||||:||||||::||||||||||:||||..|||||..|.
Zfish   126 YTAKTVVTQFVSSMSASADVLALSKIEIKLADIPEGKNMTFKWRGKPLFVRHRTEKEIETEAGVN 190

  Fly   148 TSTLRDPEADDQRVIKPEWLVVIGVCTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPL 212
            .:.||||:.|..||:.|.|::|||||||||||||||||::|||||||||||||||||||||||||
Zfish   191 LAELRDPQHDKDRVVNPSWVIVIGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPL 255

  Fly   213 NLEVPTHEFPNEGLLVVG 230
            |||||.:|||::..:|||
Zfish   256 NLEVPYYEFPDDDTVVVG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RFeSPNP_001259876.1 UCR_TM 37..100 CDD:280989 30/63 (48%)
Rieske_proteo 92..230 CDD:273610 102/137 (74%)
Rieske_cytochrome_bc1 107..230 CDD:239552 92/122 (75%)
uqcrfs1NP_001096664.1 Ubiq-Cytc-red_N 2..76 CDD:286274 6/14 (43%)
UCR_TM 79..144 CDD:280989 31/64 (48%)
Rieske_proteo 109..273 CDD:273610 116/163 (71%)
Rieske_cytochrome_bc1 150..273 CDD:239552 92/122 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577669
Domainoid 1 1.000 184 1.000 Domainoid score I3339
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4378
Inparanoid 1 1.050 288 1.000 Inparanoid score I2815
OMA 1 1.010 - - QHG51988
OrthoDB 1 1.010 - - D1174160at2759
OrthoFinder 1 1.000 - - FOG0003816
OrthoInspector 1 1.000 - - oto38886
orthoMCL 1 0.900 - - OOG6_101749
Panther 1 1.100 - - LDO PTHR10134
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1597
SonicParanoid 1 1.000 - - X2660
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.