DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and si:dkey-11o18.5

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_021324712.1 Gene:si:dkey-11o18.5 / 797166 ZFINID:ZDB-GENE-091204-110 Length:1192 Species:Danio rerio


Alignment Length:191 Identity:45/191 - (23%)
Similarity:68/191 - (35%) Gaps:50/191 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 GDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHT-----------FQSDVEGHF 192
            ||.||:|| .:||||...:.....||..|.           .|||           :...:.|..
Zfish   638 GDISCNFE-VNMCGWYQDQTDNYNWKLHSG-----------MDHTVHDGRSLVVDMWDPSLRGLS 690

  Fly   193 IRLQSQVHASRTYHFISPIYPRNLTVGHSLWFQFELFMFGSEVRNLTISVKPSSMAVEDMWNSFR 257
            .||.|....|:|.|.:|..|.                ::|.....|::.:..:..:.|.:|..  
Zfish   691 GRLLSIRQTSKTEHCLSFFYK----------------LYGPNTGALSVKLLFADGSEELLWMR-- 737

  Fly   258 NICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSETNEP 318
                    ||..|..|......:....|.||:||... .|...|.:.:|||.|::.:.:.|
Zfish   738 --------SGAHGNVWHEGHCPVPPQLSAFQLVFEAT-RSGFDGQLALDDVAFVEGQCSLP 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 40/177 (23%)
MAM 143..310 CDD:99706 40/177 (23%)
si:dkey-11o18.5XP_021324712.1 MAM 65..220 CDD:332481
LDLa 238..272 CDD:238060
MAM 278..435 CDD:99706
MAM <514..629 CDD:332481
MAM 642..786 CDD:99706 41/182 (23%)
MAM 792..947 CDD:99706
MAM 954..1104 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23282
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.