DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and Mdga1

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001355352.1 Gene:Mdga1 / 74762 MGIID:1922012 Length:956 Species:Mus musculus


Alignment Length:194 Identity:48/194 - (24%)
Similarity:80/194 - (41%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHT-----FQSDVEGHFIRLQ 196
            |:.|::|.||.|.:||:.........|.|.:|    |.:...:..:|     .....||:::.::
Mouse   748 SLSDNTCHFEDEKICGYTQDLTDNFDWTRQNA----LTQNPKRSPNTGPPTDISGTPEGYYMFIE 808

  Fly   197 SQVHASR------TYHFISPIYPRNLTVGHSLWF---QFELFMFGSEVRNLTISVKPSSMAVED- 251
            :    ||      ....:||:|      ..|..|   .|...|:|..:.:|.:.|:..:....| 
Mouse   809 T----SRPRELGDRARLVSPLY------NASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGTLDT 863

  Fly   252 -MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSE 314
             .|          ::||::|..|:...:.|:. ...||::|..|..|...|||.||||...|.|
Mouse   864 HAW----------SLSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSGYLGDIAIDDVTLKKGE 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 44/182 (24%)
MAM 143..310 CDD:99706 44/182 (24%)
Mdga1NP_001355352.1 Ig 56..115 CDD:353325
IG 152..217 CDD:214652
IG 248..326 CDD:214652
I-set 333..418 CDD:336764
IG 450..535 CDD:214652
Ig_3 538..620 CDD:339005
MAM 754..918 CDD:334181 46/188 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9081
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.