DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and MEP1B

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:211 Identity:56/211 - (26%)
Similarity:84/211 - (39%) Gaps:51/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLGTCQLANSVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHTFQSDVEG-- 190
            :|..|..:.|..| ||.||.|::||...|......|:|:|..     .:..:.||:.....:|  
Human   251 QLYNCSSSLSFMD-SCSFELENVCGMIQSSGDNADWQRVSQV-----PRGPESDHSNMGQCQGSG 309

  Fly   191 ---HFIRLQSQVHA-----SRTYHFISPIYPRNLTVGHSLWFQFELFMFGSEVRNLTISVKPSSM 247
               ||......|.|     |||      :||:.   |... .||.|:..|||...|.|.::..|.
Human   310 FFMHFDSSSVNVGATAVLESRT------LYPKR---GFQC-LQFYLYNSGSESDQLNIYIREYSA 364

  Fly   248 AVEDMWNSFRNICTKLTV--------SGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLH-GDI 303
                     .|:...||:        :|    :|:...::: ::...|:|||.....|... |.:
Human   365 ---------DNVDGNLTLVEEIKEIPTG----SWQLYHVTL-KVTKKFRVVFEGRKGSGASLGGL 415

  Fly   304 GIDDVKFIKSETNEPH 319
            .|||:..  |||..||
Human   416 SIDDINL--SETRCPH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 46/185 (25%)
MAM 143..310 CDD:99706 46/185 (25%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 1/3 (33%)
Astacin 69..257 CDD:279708 2/5 (40%)
MAM 260..427 CDD:214533 52/198 (26%)
MAM 265..427 CDD:99706 49/192 (26%)
MATH 427..586 CDD:295307 2/3 (67%)
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.