DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and Sr-CIV

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_608789.1 Gene:Sr-CIV / 33576 FlyBaseID:FBgn0031547 Length:406 Species:Drosophila melanogaster


Alignment Length:316 Identity:128/316 - (40%)
Similarity:186/316 - (58%) Gaps:23/316 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILWALRLFMIYMVIQSIASCEPDILLRNGKVTELSSWLLGDSIKFECNPGFSLQGK---TWHLGN 69
            :|||  :.:|..|.::.|.|...:.|.:|     |:.::..||.|.|:.|:.|||.   |...|.
  Fly     3 LLWA--IVLISSVDRTNARCLESVHLEHG-----STEIVNGSIIFHCDQGYFLQGSKVFTCDRGI 60

  Fly    70 GNMMKRYCAKAGCNDIEKQANGTILTATDGLKAEIECDDEFVLSGNSFTYCNGTKWIIKLGTCQL 134
            ....|.:|||:||.:.|:..||.:|.|.  :||:|.|.|...|.||...||:|.||..:||:|.|
  Fly    61 PRGKKPFCAKSGCQEYEQIQNGFVLNAP--MKAKIICSDGHGLVGNRIAYCDGEKWSTQLGSCAL 123

  Fly   135 ANSVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKC-LQQDHTFQSDVEGHFIRLQSQ 198
            .....|.|||||.||||||.|..:....|||:|..|||..||. .|:|||||:...||::|::::
  Fly   124 RRQTIDVSCDFESEDMCGWTAELSFLGTWKRVSTVADFHSEKTGPQKDHTFQNQSIGHYVRMETE 188

  Fly   199 VHASRTYHFISPIYPRNLTVGHSLWFQFELFMFGSEVRNLTISVKPSSMAVEDMWNS-----FRN 258
            ..|..||||:||:||:.|::..:. |||..|||||.|.:|.:|:||.|:.:.|::.:     |  
  Fly   189 SDAFGTYHFLSPLYPKELSLSGAC-FQFHYFMFGSGVGSLLVSIKPVSVTIGDIFKTNHPYKF-- 250

  Fly   259 ICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSE 314
              .:..::|.||..|...:|.|::|:.||||:||..|..|.:|||.|||||.:.::
  Fly   251 --DQFVMTGSQGARWLEHTIDINKMDEDFQVIFTATDARSQYGDIAIDDVKLMAAK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056 10/34 (29%)
MAM 143..310 CDD:279023 77/172 (45%)
MAM 143..310 CDD:99706 77/172 (45%)
Sr-CIVNP_608789.1 MAM 132..306 CDD:279023 78/178 (44%)
MAM 132..301 CDD:99706 78/173 (45%)
Somatomedin_B 336..376 CDD:279385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470081
Domainoid 1 1.000 66 1.000 Domainoid score I9895
eggNOG 1 0.900 - - E1_2CMY0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006092
OrthoInspector 1 1.000 - - mtm9576
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.