DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and Mdga1

DIOPT Version :10

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001401873.1 Gene:Mdga1 / 309659 RGDID:1307031 Length:956 Species:Rattus norvegicus


Alignment Length:194 Identity:48/194 - (24%)
Similarity:80/194 - (41%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHT-----FQSDVEGHFIRLQ 196
            |:.|::|.||.|.:||:.........|.|.:|    |.:...:..:|     .....||:::.::
  Rat   748 SLSDNTCHFEDEKICGYTQDLTDNFDWTRQNA----LTQNPKRSPNTGPPTDISGTPEGYYMFIE 808

  Fly   197 SQVHASR------TYHFISPIYPRNLTVGHSLWF---QFELFMFGSEVRNLTISVKPSSMAVED- 251
            :    ||      ....:||:|      ..|..|   .|...|:|..:.:|.:.|:..:....| 
  Rat   809 T----SRPRELGDRARLVSPLY------NASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGTLDT 863

  Fly   252 -MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSE 314
             .|          ::||::|..|:...:.|:. ...||::|..|..|...|||.||||...|.|
  Rat   864 HAW----------SLSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSGYLGDIAIDDVTLKKGE 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:459878 44/182 (24%)
Mdga1NP_001401873.1 Ig 54..115 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 91..95 CDD:409353
Ig strand F 105..110 CDD:409353
Ig_3 132..217 CDD:464046
IG_like 248..326 CDD:214653
Ig strand B 258..262 CDD:409353
Ig strand C 272..276 CDD:409353
Ig strand E 291..295 CDD:409353
Ig strand F 305..310 CDD:409353
Ig strand G 319..322 CDD:409353
Ig 347..418 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 368..372 CDD:409353
Ig strand E 398..402 CDD:409353
Ig strand F 412..417 CDD:409353
Ig_3 439..515 CDD:464046
Ig_3 538..620 CDD:464046
MAM 754..917 CDD:99706 46/188 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 780..799 2/18 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.