DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and Mdga1

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_006256269.1 Gene:Mdga1 / 309659 RGDID:1307031 Length:956 Species:Rattus norvegicus


Alignment Length:194 Identity:48/194 - (24%)
Similarity:80/194 - (41%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 SVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHT-----FQSDVEGHFIRLQ 196
            |:.|::|.||.|.:||:.........|.|.:|    |.:...:..:|     .....||:::.::
  Rat   748 SLSDNTCHFEDEKICGYTQDLTDNFDWTRQNA----LTQNPKRSPNTGPPTDISGTPEGYYMFIE 808

  Fly   197 SQVHASR------TYHFISPIYPRNLTVGHSLWF---QFELFMFGSEVRNLTISVKPSSMAVED- 251
            :    ||      ....:||:|      ..|..|   .|...|:|..:.:|.:.|:..:....| 
  Rat   809 T----SRPRELGDRARLVSPLY------NASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGTLDT 863

  Fly   252 -MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSE 314
             .|          ::||::|..|:...:.|:. ...||::|..|..|...|||.||||...|.|
  Rat   864 HAW----------SLSGNKGNVWQQAHVPINP-SGPFQIIFEGVRGSGYLGDIAIDDVTLKKGE 916

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 44/182 (24%)
MAM 143..310 CDD:99706 44/182 (24%)
Mdga1XP_006256269.1 IG_like 46..126 CDD:214653
Ig 56..115 CDD:299845
IG_like 152..217 CDD:214653
Ig 153..217 CDD:143165
IG_like 248..326 CDD:214653
IGc2 254..315 CDD:197706
IGc2 350..418 CDD:197706
IG_like 450..535 CDD:214653
Ig 459..535 CDD:299845
Ig 541..623 CDD:299845
IG_like 543..632 CDD:214653
MAM 754..918 CDD:279023 46/188 (24%)
MAM 754..917 CDD:99706 46/188 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 77 1.000 Domainoid score I8632
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.