DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and Cd55b

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_017169885.1 Gene:Cd55b / 13137 MGIID:104849 Length:430 Species:Mus musculus


Alignment Length:110 Identity:37/110 - (33%)
Similarity:46/110 - (41%) Gaps:11/110 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SCEPDILLRNGKVTELSSWLLGDSIKFECNPGFSLQGKTWHLGN--GNMMK-----RYCAKAGCN 83
            ||.....|.||.:...:..|.|..|.|.||||:.|.|.|..|..  ||.:.     ..|.:..|.
Mouse   178 SCPNPKDLDNGHINIPTGILFGSEINFSCNPGYRLVGITSILCTIIGNTVDWDDEFPVCTEIFCP 242

  Fly    84 DIEKQANGTILTATDGLKAE----IECDDEFVLSGNSFTYCNGTK 124
            |..|..||.:...:|..|..    ..||..|:|.|||..||..:|
Mouse   243 DPPKINNGIMRGESDSYKYSQVVIYSCDKGFILFGNSTIYCTVSK 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056 13/34 (38%)
MAM 143..310 CDD:279023
MAM 143..310 CDD:99706
Cd55bXP_017169885.1 CCP 52..111 CDD:153056
PHA02927 110..>297 CDD:222943 37/110 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12629
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.