Sequence 1: | NP_524747.1 | Gene: | Sr-CIII / 44382 | FlyBaseID: | FBgn0020376 | Length: | 320 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031747317.1 | Gene: | mdga2 / 100490514 | XenbaseID: | XB-GENE-6046933 | Length: | 983 | Species: | Xenopus tropicalis |
Alignment Length: | 197 | Identity: | 43/197 - (21%) |
---|---|---|---|
Similarity: | 71/197 - (36%) | Gaps: | 51/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 143 CDFEREDMCGWRASKAIPQPWKRISAA---------------ADFLKEKCLQQDHTFQSDVEGHF 192
Fly 193 IRLQSQVHASRTYHFISPI--------YPRNLTVGHSLWFQFELFMFGSEVRNLTISVKPSSMAV 249
Fly 250 ED--MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIK 312
Fly 313 SE 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sr-CIII | NP_524747.1 | CCP | 27..>62 | CDD:153056 | |
MAM | 143..310 | CDD:279023 | 42/191 (22%) | ||
MAM | 143..310 | CDD:99706 | 42/191 (22%) | ||
mdga2 | XP_031747317.1 | Ig | 69..141 | CDD:416386 | |
Ig strand B | 81..85 | CDD:409353 | |||
Ig strand C | 94..98 | CDD:409353 | |||
Ig strand E | 116..120 | CDD:409353 | |||
Ig strand F | 130..135 | CDD:409353 | |||
IG | 177..246 | CDD:214652 | |||
Ig | 271..342 | CDD:416386 | |||
Ig strand A | 271..275 | CDD:409353 | |||
Ig strand B | 285..295 | CDD:409353 | |||
Ig strand C | 301..305 | CDD:409353 | |||
Ig strand C' | 307..309 | CDD:409353 | |||
Ig strand D | 314..319 | CDD:409353 | |||
Ig strand E | 320..326 | CDD:409353 | |||
Ig strand F | 333..341 | CDD:409353 | |||
Ig | 376..451 | CDD:416386 | |||
Ig strand B | 382..386 | CDD:409353 | |||
Ig strand C | 397..401 | CDD:409353 | |||
Ig strand E | 427..431 | CDD:409353 | |||
Ig strand F | 441..446 | CDD:409353 | |||
Ig strand G | 455..458 | CDD:409353 | |||
IG | 478..549 | CDD:214652 | |||
IG_like | 580..654 | CDD:214653 | |||
MAM | 775..947 | CDD:395504 | 43/197 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |