DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sr-CIII and mdga2

DIOPT Version :9

Sequence 1:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_031747317.1 Gene:mdga2 / 100490514 XenbaseID:XB-GENE-6046933 Length:983 Species:Xenopus tropicalis


Alignment Length:197 Identity:43/197 - (21%)
Similarity:71/197 - (36%) Gaps:51/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 CDFEREDMCGWRASKAIPQPWKRISAA---------------ADFLKEKCLQQDHTFQSDVEGHF 192
            |.||..::|.:.........|.:.||:               |...|........|.:..::|..
 Frog   775 CGFEESNICLFTQDDTDIFDWTKQSASTRDTRYTPNTGPTTDAGGSKHGFYMYIETSRPRMDGEK 839

  Fly   193 IRLQSQVHASRTYHFISPI--------YPRNLTVGHSLWFQFELFMFGSEVRNLTISVKPSSMAV 249
            .||            :|||        |..:.||   ..|.|...|:|..:..|.|.::......
 Frog   840 ARL------------LSPIFNIAQKNPYGSSNTV---YCFSFFYHMYGKHIGALNIFLRLKGQTS 889

  Fly   250 ED--MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIK 312
            .|  :|::          .|::|..||...::| ...|.||::|..:....:.|||.|||:..::
 Frog   890 TDIPLWSA----------KGNKGEQWKQTHLNI-HPTSSFQLIFEGIRGDGIEGDIAIDDISIME 943

  Fly   313 SE 314
            .|
 Frog   944 GE 945

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 42/191 (22%)
MAM 143..310 CDD:99706 42/191 (22%)
mdga2XP_031747317.1 Ig 69..141 CDD:416386
Ig strand B 81..85 CDD:409353
Ig strand C 94..98 CDD:409353
Ig strand E 116..120 CDD:409353
Ig strand F 130..135 CDD:409353
IG 177..246 CDD:214652
Ig 271..342 CDD:416386
Ig strand A 271..275 CDD:409353
Ig strand B 285..295 CDD:409353
Ig strand C 301..305 CDD:409353
Ig strand C' 307..309 CDD:409353
Ig strand D 314..319 CDD:409353
Ig strand E 320..326 CDD:409353
Ig strand F 333..341 CDD:409353
Ig 376..451 CDD:416386
Ig strand B 382..386 CDD:409353
Ig strand C 397..401 CDD:409353
Ig strand E 427..431 CDD:409353
Ig strand F 441..446 CDD:409353
Ig strand G 455..458 CDD:409353
IG 478..549 CDD:214652
IG_like 580..654 CDD:214653
MAM 775..947 CDD:395504 43/197 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.