DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm17b

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001072242.1 Gene:timm17b / 779691 XenbaseID:XB-GENE-6454019 Length:156 Species:Xenopus tropicalis


Alignment Length:146 Identity:93/146 - (63%)
Similarity:118/146 - (80%) Gaps:0/146 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||.|||||.||||||||||.||.:|||:||.:|||||||.|:..|:.||::|::.::|.||||
 Frog     1 MEEYMREPCPWRIVDDCGGAFTMGIIGGGVFQAVKGFRNAPAGVAHRLRGSMSAVRIRAPQIGGS 65

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            ||.||.:||.:||.||..|.||||||||.|||:||.:||||:|..||.|||::||:||::|||:|
 Frog    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLASRSGPLAMVGSALMGGILLALIEGVG 130

  Fly   131 IFFTRFAAEQFRNREP 146
            |..||:.|:||:|..|
 Frog   131 ILLTRYTAQQFQNPNP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 93/146 (64%)
timm17bNP_001072242.1 Tim17 1..146 CDD:321914 92/144 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 167 1.000 Domainoid score I3798
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3458
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm9374
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.