DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm17b

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001107065.1 Gene:timm17b / 562144 ZFINID:ZDB-GENE-081104-144 Length:167 Species:Danio rerio


Alignment Length:166 Identity:98/166 - (59%)
Similarity:124/166 - (74%) Gaps:7/166 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEEYSREPCPHRIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPVIGGS 65
            ||||:|||||.||||||||||.||.:|||:||.:|||||||.|:..|:.||..|::.::|.||||
Zfish     1 MEEYAREPCPWRIVDDCGGAFTMGAIGGGVFQTVKGFRNAPVGVRHRLRGSANAVRVRAPQIGGS 65

  Fly    66 FAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLLSMIEGLG 130
            ||.||.:||.:||.||..|.||||||||.|||:||.|||:|:|..||.|||::||:||::|||.|
Zfish    66 FAVWGGLFSTIDCGLVRLRGKEDPWNSITSGAMTGAILAARSGPLAMVGSAMMGGILLALIEGFG 130

  Fly   131 IFFTRFAAEQFRNREPHI-----MPDANE--GYGDF 159
            |..||:.|:||:|..|.:     :|...|  |||.:
Zfish   131 ILLTRYTAQQFQNSSPIVEDPKQLPPKEEARGYGQY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 93/154 (60%)
timm17bNP_001107065.1 Tim17 1..167 CDD:295283 98/166 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586878
Domainoid 1 1.000 169 1.000 Domainoid score I3766
eggNOG 1 0.900 - - E1_COG5596
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3502
OMA 1 1.010 - - QHG54844
OrthoDB 1 1.010 - - D1590221at2759
OrthoFinder 1 1.000 - - FOG0001103
OrthoInspector 1 1.000 - - mtm6432
orthoMCL 1 0.900 - - OOG6_101935
Panther 1 1.100 - - O PTHR10485
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X753
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.