DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tim17b2 and timm22

DIOPT Version :9

Sequence 1:NP_001285956.1 Gene:Tim17b2 / 44381 FlyBaseID:FBgn0020371 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001011397.1 Gene:timm22 / 496870 XenbaseID:XB-GENE-5754351 Length:186 Species:Xenopus tropicalis


Alignment Length:145 Identity:40/145 - (27%)
Similarity:57/145 - (39%) Gaps:39/145 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RIVDDCGGAFIMGCVGGGLFQGLKGFRNAPQGLGRRVAGSVAAIKTKSPV--------------- 61
            |:::.||....:.||||.:..|..|...|  |:...|     ....|.|.               
 Frog    56 RVMESCGFKAALACVGGFVLGGAFGVFTA--GIDTNV-----GFDPKDPYRTPTAKEVLKDMGQR 113

  Fly    62 ---IGGSFAAWGAVFSIVDCSLVHFRQKEDPWNSIVSGAVTGGILASRNGAAAMAGSAIIGGVLL 123
               ...:||..||:||..:|.:..:|.|.|..||::||.:|||.:..|  |...||:...||   
 Frog   114 GMSYAKNFAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFR--AGLKAGALGCGG--- 173

  Fly   124 SMIEGLGIFFTRFAA 138
                     |..|:|
 Frog   174 ---------FAAFSA 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tim17b2NP_001285956.1 Tim17 1..151 CDD:295283 40/145 (28%)
timm22NP_001011397.1 Tim17 60..182 CDD:280604 39/141 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.